[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV56234.1

[Show Plain Result]


## Summary of Sequence Search
    1::144
    1::123     1e-16  35%  126 aa  PF01592 NifU_N "NifU-like N terminal domain"
    1::144

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxIYTAALMEHNAHPDYKYQMDEPTCTHDGVNPSCGDELTLSLRLRGDRIEEAAFTGHGCAVSQAAADM
PF01592         ---LYSEKILDHYKNPRNVGELDDADAGTGHVNPTCGDEITLQLKVDDDGIEDAKFDGFGCAISQASASM


                         .         .         *         .         .         .         .:140
query           MADLVTGETVGEARRLSGLYLDMIKGRPXXXXXXXXXXXXXXXXSIARMPARVxxxxxxxxxxxxxxxxx
PF01592         MTELVKGKTVDEALALKNTIFEELMGLPPVKIHCSVLADAALKAAVSKYPARI-----------------


                         +         .         .         .         .         *         .:210
query           xxxx
PF01592         ----