[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV56581.1

[Show Plain Result]


## Summary of Sequence Search
    1::109
    1::106     2e-16  41%  107 aa  PF10665 Phage_Gp9 "Phage protein Gp9"
    1::109

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxIPKRALPSTAAVRVPLEGDYGGEFAEPVAIGHVRYEKAAGIRRTDYQLQDGTTGIVFIDAVNSEGAF
PF10665         ---IDKRLLIDTVTYKVADKDDYGGGYSEPVTIENVRFDRNKAYSGTGNSRQDVKNGVIFIDAVNSNPAF


                         .         .         *         .         .         .         .:140
query           EVPASSMVSIDGAPEVCVNACHPREQFAGRVHHWELEVx
PF10665         DFSEGSKVVFDG-KEYTINKVIPNYEPSGKIHHWEVEV-