[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV56703.1

[Show Plain Result]


## Summary of Sequence Search
    1::471
   37::154     5e-10  31%  347 aa  PF07690 MFS_1 "Major Facilitator Superfamily"
    1::471

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLTTSY
PF07690         -----------------------------------------------------------------LLSAF


                         .         .         *         .         .         .         .:140
query           MLVLGITVPVATFLSRRFSVRQHVFIALAFFLVGALADLFAPNFGVLLAGRVFQAISTGMLMPLMQTIAM
PF07690         LLGYALGSPPAGPLADRFGRRRVLLLGLLLFALGSLLLAFASNSWLLLVARFLQGLGAGGLFPAASALIA


                         +         .         .         .         .         *         .:210
query           TRFPRGRQATAMGVAGIAMGFAPNIGPTIGGAMSFSLGWRSFFxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         DWFPPEERGRALGIFSAGGGLGAALGPLLGGLLAESLGWRWAF---------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         ---------------------------------------------------