[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for elen0:ACV56840.1

[Show Plain Result]


## Summary of Sequence Search
    1::435
    1::208     3e-56  59%  208 aa  PF00809 Pterin_bind "Pterin binding enzyme"
   13::126     3e-23  50%  126 aa  PF01288 HPPK "7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
   61::106     6e-04  37%  163 aa  PF08795 DUF1796 "Putative papain-like cysteine peptidase (DUF1796)"
    1::435

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVS
PF00809         -------------------ILNVTPDSFSDGGKFFDLEAALERAREMVEEGADIIDIGGESTRPGAAPVS
PF01288         ----------------------------------------------------------------------
PF08795         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VDEELARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVRDSDCGLVVMHM
PF00809         EEEELARVVPVIKAIRDADVPISIDTYRAEVAEAALKAGADIINDVSGEEDPEMLPLVAKYGAPVVLMHM
PF01288         ----------------------------------------------------------------------
PF08795         ---------------------------------------------ISFWPDPVAKWLLRDSQYGCFSHHD


                         +         .         .         .         .         *         .:210
query           QGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPSQTLELVRNFQEFVRLG
PF00809         RGDPQGMQDTPDYRDVVEEVYRFLEERIEAAEAAGIPRERIILDPGIGFGKTEEHNLELLRRLEELRELG
PF01288         ----------------------------------------------------------------------
PF08795         FNDPNSPEDWPSYEDVKAKLR-------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YPVMVAVSRKSFLGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00809         YPVLVGGSRKSFIG--------------------------------------------------------
PF01288         ----------------------------------------------------------------------
PF08795         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELL
PF00809         ----------------------------------------------------------------------
PF01288         ---------------ANLRAALAALAEL-GIRVLAVSSLYETPPVGPEDQPDFLNAVVVVETELSPLELL
PF08795         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQPLLELxxxxxxxxxx
PF00809         ----------------------------------------------------------------------
PF01288         DRLKAIEQEFGRVRSERWGPRTLDLDILLYGDLVIDTPRLTLPHPRLHERAFVLVPLAEI----------
PF08795         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxx
PF00809         ---------------
PF01288         ---------------
PF08795         ---------------