[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV54068.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1f6vA.bssp"
#ERROR : Can't open dsspfile "2jn6A1.bssp"
#ERROR : Can't open dsspfile "2b0lA1.bssp"
#ERROR : Can't open dsspfile "1qbjA.bssp"
#ERROR : Can't open dsspfile "1fp2A1.bssp"
#ERROR : Can't open dsspfile "1xd7A.bssp"
#ERROR : Can't open dsspfile "1oyiA.bssp"
#ERROR : Can't open dsspfile "2htjA1.bssp"
#ERROR : Can't open dsspfile "1q1hA.bssp"
#ERROR : Can't open dsspfile "1zybA1.bssp"
#ERROR : Can't open dsspfile "1mkmA1.bssp"
#ERROR : Can't open dsspfile "2hs5A1.bssp"
#ERROR : Can't open dsspfile "1o57A1.bssp"

## Summary of PDB Search
:158
    1e-07  23%  1f6vA  [a.49.1.1] DNA TRANSPOSITION PROTEIN
    1e-07  14%  2jn6A1 [a.4.1.19] PROTEIN CGL2762 A:1 -- 89
    9e-07  19%  2b0lA1 [a.4.5.66] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC A:167
    2e-06  15%  1qbjA  [a.4.5.19] PROTEIN (DOUBLE-STRANDED RNA SPECIFIC ADENOSINE
    3e-06  16%  1fp2A1 [a.4.5.29] ISOFLAVONE O-METHYTRANSFERASE A:8 -- 108
    3e-05  25%  1xd7A  [a.4.5.55] YWNA
    5e-05   2%  1oyiA  [a.4.5.19] DOUBLE-STRANDED RNA-BINDING PROTEIN
    1e-04  20%  2htjA1 [a.4.5.73] P FIMBRIAL REGULATORY PROTEIN KS71A A:1 -- 73
    4e-04  20%  1q1hA  [a.4.5.41] TRANSCRIPTION FACTOR E
    4e-04  13%  1zybA1 [a.4.5.4] TRANSCRIPTION REGULATOR, CRP FAMILY A:148 -- 220
    6e-04  12%  1mkmA1 [a.4.5.33] ICLR TRANSCRIPTIONAL REGULATOR A:1 -- 75
    0.001  17%  2hs5A1 [a.4.5.6] PUTATIVE TRANSCRIPTIONAL REGULATOR GNTR A:25 --
    0.001  21%  1o57A1 [a.4.5.40] PUR OPERON REPRESSOR A:2 -- 74
:158

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQLKASTDYGMRAILYLAAQGTTCSSKDIAEDMSIPRDYLIQLAQLLRNAGIIEARPGKHGGYRLAKDPA
1f6vA           ---------GSRIAKRTAINTKKADVKAIADAWQINGEKELELLQQIA---------QKPGALRILNHSA
2jn6A1          MPTKTYSEEFKRDAVALYENSDGASLQQIANDLGINRVTLKNWIIKYGSNHNVQGTTPSAAVSEAEQIRQ
2b0lA1          -----------HIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGTYIK-VLN
1qbjA           -----------LKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIA----
1fp2A1          -----KWAVEMNIPNIIQNHGKPISLSNLVSILQVPSGNVRRLMRYLAHNGFFEIITKEEESYALTVAS-
1xd7A           ------------HILSLISMDEKTSSEIIADSVNTNPVVVRRMISLLKKADILTSRAGV-PGASLKKDPA
1oyiA           ------------------------TAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMT----
2htjA1          -----------NEILEFLNRHNGGKTAEIAEALAVTDYQARYYLLLLEKAGMVQRSPLRRGMATYWF---
1q1hA           -------------------KGTEMTDEEIANQLNIKVNDVRKKLNLLEEQGFVSYRKTR-SGWFIYYWKP
1zybA1          -----------HCEKPQGEKTFKVKXDDLARCLDDTRLNISKTLNELQDNGLIELHRK--EILIPDAQ--
1mkmA1          -----TLKKAFEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKD--KRYVP-----
2hs5A1          -------------IDGTFRPGARLSEPDICAALDVSRNTVREAFQILIEDRLVAHELN--RGVFVRV---
1o57A1          ----------LVDLTNYLLTHELIPLTFFSEKSSISED-LTIIKQTFEQQGILLTVPGAAGGVKYIPK--


                         .         .         *         .         .         .         .:140
query           DTNVLEIMEALDDDAKQSTRAKRDARKGGAMVQEIKQVYDLIEExxxxxxxxxxxxxxxxxxxxxxxxxx
1f6vA           MTAHGKGERVNEDY--------------------------------------------------------
2jn6A1          LKKENALQRARTRHPAE-----------------------------------------------------
2b0lA1          NKFLIELEN-------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1fp2A1          ----------------------------------------------------------------------
1xd7A           DISLLEVYRAVQKNPKCPVGKKIQNALDETFESVQRAMENELAS--------------------------
1oyiA           ----------------------------------------------------------------------
2htjA1          ----------------------------------------------------------------------
1q1hA           N---------------------------------------------------------------------
1zybA1          ----------------------------------------------------------------------
1mkmA1          ----------------------------------------------------------------------
2hs5A1          ----------------------------------------------------------------------
1o57A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxx
1f6vA           ------------------
2jn6A1          ------------------
2b0lA1          ------------------
1qbjA           ------------------
1fp2A1          ------------------
1xd7A           ------------------
1oyiA           ------------------
2htjA1          ------------------
1q1hA           ------------------
1zybA1          ------------------
1mkmA1          ------------------
2hs5A1          ------------------
1o57A1          ------------------