[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV54358.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1d4cA2.bssp"
#ERROR : Can't open dsspfile "1d4cA3.bssp"
#ERROR : Can't open dsspfile "1e7pA2.bssp"
#ERROR : Can't open dsspfile "1pj5A2.bssp"
#ERROR : Can't open dsspfile "2ivdA1.bssp"
#ERROR : Can't open dsspfile "1cf3A1.bssp"
#ERROR : Can't open dsspfile "2pnwA1.bssp"
#ERROR : Can't open dsspfile "1jnrA2.bssp"
#ERROR : Can't open dsspfile "2gqfA1.bssp"
#ERROR : Can't open dsspfile "1kdgA1.bssp"
#ERROR : Can't open dsspfile "1vqwA2.bssp"
#ERROR : Can't open dsspfile "1el5A1.bssp"
#ERROR : Can't open dsspfile "1p9oA.bssp"
#ERROR : Can't open dsspfile "1f8rA1.bssp"
#ERROR : Can't open dsspfile "1ng3A1.bssp"
#ERROR : Can't open dsspfile "2i0zA1.bssp"
#ERROR : Can't open dsspfile "1bf3A1.bssp"
#ERROR : Can't open dsspfile "1w4xA2.bssp"
#ERROR : Can't open dsspfile "1sezA1.bssp"
#ERROR : Can't open dsspfile "1an9A1.bssp"
#ERROR : Can't open dsspfile "1h6vA2.bssp"
#ERROR : Can't open dsspfile "1gosA1.bssp"
#ERROR : Can't open dsspfile "1d7yA1.bssp"
#ERROR : Can't open dsspfile "1b4vA1.bssp"
#ERROR : Can't open dsspfile "1dxlA2.bssp"
#ERROR : Can't open dsspfile "2dw4A2.bssp"
#ERROR : Can't open dsspfile "1tzlA1.bssp"
#ERROR : Can't open dsspfile "2culA1.bssp"
#ERROR : Can't open dsspfile "2vouA1.bssp"
#ERROR : Can't open dsspfile "1onfA2.bssp"
#ERROR : Can't open dsspfile "1cjcA2.bssp"
#ERROR : Can't open dsspfile "1djnA3.bssp"
#ERROR : Can't open dsspfile "1lnqA3.bssp"
#ERROR : Can't open dsspfile "1gt8A4.bssp"
#ERROR : Can't open dsspfile "1vqwA1.bssp"
#ERROR : Can't open dsspfile "1f0yA2.bssp"
#ERROR : Can't open dsspfile "1bwcA2.bssp"
#ERROR : Can't open dsspfile "1b6rA2.bssp"
#ERROR : Can't open dsspfile "1f8wA1.bssp"
#ERROR : Can't open dsspfile "1bhyA1.bssp"
#ERROR : Can't open dsspfile "1uaiA.bssp"
#ERROR : Can't open dsspfile "1fohA5.bssp"
#ERROR : Can't open dsspfile "1ltxR1.bssp"
#ERROR : Can't open dsspfile "1b37A1.bssp"
#ERROR : Can't open dsspfile "1hyhA1.bssp"
#ERROR : Can't open dsspfile "1aogA2.bssp"
#ERROR : Can't open dsspfile "1mo9A2.bssp"
#ERROR : Can't open dsspfile "1b73A1.bssp"
#ERROR : Can't open dsspfile "1evyA2.bssp"
#ERROR : Can't open dsspfile "1bncA2.bssp"
#ERROR : Can't open dsspfile "1d7yA2.bssp"
#ERROR : Can't open dsspfile "1w4xA1.bssp"
#ERROR : Can't open dsspfile "1f8gA1.bssp"
#ERROR : Can't open dsspfile "1ks9A2.bssp"
#ERROR : Can't open dsspfile "1sr8A.bssp"
#ERROR : Can't open dsspfile "1i8tA1.bssp"
#ERROR : Can't open dsspfile "2f5tX1.bssp"

## Summary of PDB Search
:589
    2e-18  20%  1d4cA2 [c.3.1.4] FLAVOCYTOCHROME C FUMARATE REDUCTASE A:103 -- 359
    5e-16  26%  1d4cA3 [d.168.1.1] FLAVOCYTOCHROME C FUMARATE REDUCTASE A:360 --
    1e-10  21%  1e7pA2 [c.3.1.4] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT A:1 -- 250
    5e-09  14%  1pj5A2 [c.3.1.2] N,N-DIMETHYLGLYCINE OXIDASE A:4 -- 219 A:339 --
    4e-08  33%  2ivdA1 [c.3.1.2] PROTOPORPHYRINOGEN OXIDASE A:10 -- 306 A:415 --
    5e-08  12%  1cf3A1 [c.3.1.2] PROTEIN (GLUCOSE OXIDASE) A:3 -- 324 A:521 -- 583
    6e-08   7%  2pnwA1 [b.52.1.4] MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE A:5
    9e-08  17%  1jnrA2 [c.3.1.4] ADENYLYLSULFATE REDUCTASE A:2 -- 256 A:402 -- 502
    1e-07  23%  2gqfA1 [c.3.1.8] HYPOTHETICAL PROTEIN HI0933 A:1 -- 194 A:343 --
    5e-07  10%  1kdgA1 [c.3.1.2] CELLOBIOSE DEHYDROGENASE A:215 -- 512 A:694 -- 755
    8e-07  12%  1vqwA2 [c.3.1.5] PROTEIN WITH SIMILARITY TO FLAVIN-CONTAINING A:181
    8e-07  14%  1el5A1 [c.3.1.2] SARCOSINE OXIDASE A:1 -- 217 A:322 -- 385
    1e-06  13%  1p9oA  [c.72.3.1] PHOSPHOPANTOTHENOYLCYSTEINE SYNTHETASE
    2e-06  31%  1f8rA1 [c.3.1.2] L-AMINO ACID OXIDASE A:4 -- 319 A:433 -- 486
    3e-06  16%  1ng3A1 [c.3.1.2] GLYCINE OXIDASE A:1 -- 218 A:307 -- 364
    6e-06  17%  2i0zA1 [c.3.1.8] NAD(FAD)-UTILIZING DEHYDROGENASES A:1 -- 192 A:362
    8e-06  15%  1bf3A1 [c.3.1.2] P-HYDROXYBENZOATE HYDROXYLASE A:1 -- 173 A:276 --
    8e-06  14%  1w4xA2 [c.3.1.5] PHENYLACETONE MONOOXYGENASE A:155 -- 389
    9e-06  48%  1sezA1 [c.3.1.2] PROTOPORPHYRINOGEN OXIDASE, MITOCHONDRIAL A:13 --
    2e-05  25%  1an9A1 [c.4.1.2] D-AMINO ACID OXIDASE A:1 -- 194 A:288 -- 340
    2e-05  22%  1h6vA2 [c.3.1.5] THIOREDOXIN REDUCTASE A:171 -- 292
    3e-05  12%  1gosA1 [c.3.1.2] MONOAMINE OXIDASE A:4 -- 289 A:402 -- 500
    3e-05   9%  1d7yA1 [c.3.1.5] FERREDOXIN REDUCTASE A:5 -- 115 A:237 -- 308
    3e-05  12%  1b4vA1 [c.3.1.2] PROTEIN (CHOLESTEROL OXIDASE) A:9 -- 318 A:451 --
    3e-05  25%  1dxlA2 [c.3.1.5] DIHYDROLIPOAMIDE DEHYDROGENASE A:153 -- 275
    4e-05  32%  2dw4A2 [c.3.1.2] LYSINE-SPECIFIC HISTONE DEMETHYLASE 1 A:274 -- 654
    4e-05  18%  1tzlA1 [c.3.1.2] PYRANOSE OXIDASE A:43 -- 354 A:553 -- 619
    4e-05  12%  2culA1 [c.3.1.7] GLUCOSE-INHIBITED DIVISION PROTEIN A-RELATED A:2
    4e-05  17%  2vouA1 [c.3.1.2] 2,6-DIHYDROXYPYRIDINE HYDROXYLASE A:2 -- 163 A:292
    5e-05  14%  1onfA2 [c.3.1.5] GLUTATHIONE REDUCTASE A:154 -- 270
    6e-05  17%  1cjcA2 [c.4.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:6 -- 106 A:332
    6e-05  19%  1djnA3 [c.4.1.1] TRIMETHYLAMINE DEHYDROGENASE A:341 -- 489 A:646 --
    7e-05  14%  1lnqA3 [c.2.1.9] POTASSIUM CHANNEL RELATED PROTEIN A:116 -- 244
    8e-05  31%  1gt8A4 [c.4.1.1] DIHYDROPYRIMIDINE DEHYDROGENASE A:184 -- 287 A:441
    8e-05  17%  1vqwA1 [c.3.1.5] PROTEIN WITH SIMILARITY TO FLAVIN-CONTAINING A:3
    9e-05  12%  1f0yA2 [c.2.1.6] L-3-HYDROXYACYL-COA DEHYDROGENASE A:12 -- 203
    9e-05  14%  1bwcA2 [c.3.1.5] PROTEIN (GLUTATHIONE REDUCTASE) A:166 -- 290
    1e-04  22%  1b6rA2 [c.30.1.1] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE
    1e-04  19%  1f8wA1 [c.3.1.5] NADH PEROXIDASE A:1 -- 119 A:243 -- 321
    1e-04  10%  1bhyA1 [c.3.1.5] P64K A:117 -- 275 A:401 -- 470
    1e-04   6%  1uaiA  [b.29.1.18] POLYGULURONATE LYASE
    1e-04  13%  1fohA5 [c.3.1.2] PHENOL HYDROXYLASE A:1 -- 240 A:342 -- 461
    2e-04   8%  1ltxR1 [c.3.1.3] RAB ESCORT PROTEIN 1 R:2 -- 444 R:558 -- 614
    2e-04  31%  1b37A1 [c.3.1.2] PROTEIN (POLYAMINE OXIDASE) A:5 -- 293 A:406 --
    2e-04  14%  1hyhA1 [c.2.1.5] L-2-HYDROXYISOCAPROATE DEHYDROGENASE A:21 -- 166
    3e-04  15%  1aogA2 [c.3.1.5] TRYPANOTHIONE REDUCTASE A:170 -- 286
    4e-04   7%  1mo9A2 [c.3.1.5] ORF3 A:193 -- 313
    4e-04  12%  1b73A1 [c.78.2.1] GLUTAMATE RACEMASE A:1 -- 105
    5e-04  20%  1evyA2 [c.2.1.6] GLYCEROL-3-PHOSPHATE DEHYDROGENASE A:9 -- 197
    5e-04  17%  1bncA2 [c.30.1.1] BIOTIN CARBOXYLASE A:1 -- 114
    5e-04  26%  1d7yA2 [c.3.1.5] FERREDOXIN REDUCTASE A:116 -- 236
    6e-04   9%  1w4xA1 [c.3.1.5] PHENYLACETONE MONOOXYGENASE A:10 -- 154 A:390 --
    6e-04  25%  1f8gA1 [c.2.1.4] NICOTINAMIDE NUCLEOTIDE TRANSHYDROGENASE A:144 --
    7e-04  25%  1ks9A2 [c.2.1.6] 2-DEHYDROPANTOATE 2-REDUCTASE A:1 -- 167
    7e-04  20%  1sr8A  [e.54.1.1] COBALAMIN BIOSYNTHESIS PROTEIN (CBID)
    8e-04  22%  1i8tA1 [c.4.1.3] UDP-GALACTOPYRANOSE MUTASE A:1 -- 244 A:314 -- 367
    9e-04   7%  2f5tX1 [b.38.5.1] ARCHAEAL TRANSCRIPTIONAL REGULATOR TRMB X:247 --
:589

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWAFE
1d4cA2          ----------------------------------------------------------------------
1d4cA3          ----------------------------------------------------------------------
1e7pA2          ----------------------------------------------------------------------
1pj5A2          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1cf3A1          ----------------------------------------------------------------------
2pnwA1          ----------------------------------------------------------------------
1jnrA2          ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1kdgA1          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1f8rA1          ------------------------------------------------------------------EFLE
1ng3A1          ----------------------------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
1bf3A1          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1dxlA2          ---------------------------------------------------------------------T
2dw4A2          ----------------------------------------------------------------------
1tzlA1          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1djnA3          --------------------------------------------------------------------EE
1lnqA3          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1bhyA1          ----------------------------------------------------------------------
1uaiA           ----------------------------------------------------------------------
1fohA5          ----------------------------------------------------------------------
1ltxR1          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1w4xA1          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1sr8A           ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
2f5tX1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IAPEPVADSEIAQAYEADIIVVGAGVSGLACAASATEEGADVILFAASSQPVARGGSNHGIGTKFHERLG
1d4cA2          ---------------TTDVVIIGSGGAGLAAAVSARDAGAKVILLEKEPIPGGNTKLAAGGMNAAETKPQ
1d4cA3          ----------------------------------------------------------------------
1e7pA2          -----------------DSLVIGGGLAGLRAAVATQQKGLSTIVVKRSHSAAAQGGMQASLGSKMSD---
1pj5A2          ----------------PRIVIIGAGIVGTNLAELVTRGWNNITVLDQGPLNMPGGSTSHAPGLVFQTNPS
2ivdA1          -----------------NVAVVGGGISGLAVAHHLRSRGTDAVLLESSARLGGAVGTHA-----------
1cf3A1          --------------QTALIRSGNGLGGSTLVNGGTWTRPHKAQVDSWETVFGNEGWNWDNVYSLQAERAR
2pnwA1          ----------------------------------------------------------------------
1jnrA2          ------ADEVPTEVVETDILIIGGGFSGCGAAYEAAYWAKLGGLKVTLVEKAAVERSGAVAQGLSAINTY
2gqfA1          -----------------ENIIIGAGAAGLFCAAQLAKLGKSVTVFDNGKKIGRKLXSGGGFCNFTNLEVT
1kdgA1          ---------------PYDYIIVGAGPGGIIAADRLSEAGKKVLLLER--GGPSTKQTGGTYVAPWATSSG
1vqwA2          -----------------SVLVVGGASSANDLVRHLTPVAKHPIYQSLLGGGDIQNESLQQVPEFDPTTRE
1el5A1          ----------------FDVIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPHTNGSHHGDTRIIRHAYGE
1p9oA           ----------------RFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPY----------------
1f8rA1          IARNGLK----ATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERP-------------------
1ng3A1          ---------------HYEAVVIGGGIIGSAIAYYLAKENKNTALFESGTMGGRTTSAAAGMLGAHAECEE
2i0zA1          ---------------HYDVIVIGGGPSGLMAAIGAAEEGANVLLLDKGNKLGRKLAISGGGRCNVTNRLP
1bf3A1          ---------------KTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGKIRAGV---LEQGMV
1w4xA2          -----------------RVGVIGTGSSGIQVSPQIAKQAAELFVFQRTPHFAVP-ARNAPLDPEFLADL-
1sezA1          ------------------VAVIGAGVSGLAAAYKLKIHGLN-----------------------------
1an9A1          ------------------VVVIGAGVIGLSTALCIHERYHSVLQPLDADRFTPFTTTDVAAG--------
1h6vA2          ------------------TLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHG
1gosA1          ---------------KCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGG
1d7yA1          -----------------PVVVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSDFMAHGDAE
1b4vA1          ---------------YVPAVVIGTGYGAAVSALRLGEAGVQTLMLEMGQLWNQPGPDGNIFCGMLNPDKR
1dxlA2          IDEKKIVSSTGALALSEKLVVIGAGYIGLEMGSVWGRIGSEVTVVEFASEIVPT----------------
2dw4A2          ------------------VIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVA-----
1tzlA1          --------------IKYDVVIVGSGPIGCTYARELVGAGYKVAXFDIGEIDSGLKGAHKKNTVEYQ----
2culA1          -----------------QVLIVGAGFSGAETAFWLAQKGVRVGLLTQS----LDAVMMPFLPPKPPFPPG
2vouA1          -----------------RIAVVGGSISGLTAALMLRDAGVDVDVYERSPQPLSGFGTGIVVQPELVHYLL
1onfA2          ------------------IGIVGSGYIAVELINVIKRLGIDSYIFARGNRILRKDESVINVLENDMKKNN
1cjcA2          -----------------QICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRGVAPDHPEVKNV
1djnA3          YRRGWHPEKFRQTKNKDSVLIVGAGPSGSEAARVLMESGYTVHLTDTAEKIGGHLNQVAAL-PGLGEWSY
1lnqA3          ------------------VVICGWSESTLECLRELRGSEVFVLAEDENVRKKV-----------------
1gt8A4          ------------EAYSAKIALLGAGPASISCASFLARLGYDITIFEKQEYV-------------------
1vqwA1          -----------------KIAIIGAGPSGLVTAKALLAEKAFDQVTLFERRGSPGGVWNYTSTLSNKLPVP
1f0yA2          -----------------HVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIESLRKVAKKKF
1bwcA2          -----------------RSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSDSMISTNCTEELENAG
1b6rA2          ------------------VCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAV----------------
1f8wA1          ------------------VIVLGSSHGGYEAVEELLNLHPDAEIQ-------------------------
1bhyA1          -----------SADAEYDVVVLGGGPGGYSAAFAAADEGLKVAIVERYKTLGGVCLNVGCIPSKALLHNA
1uaiA           ----------------------------------------------------------------------
1fohA5          -----------------DVLIVGAGPAGLMAARVLSEYVRQKPDLKVRIIDKRSTKVYNGQADGLQCRTL
1ltxR1          ---------------DFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFSFSGLLNTENSM
1b37A1          ------------------VIVVGAGMSGISAAKRLSEAGTDLLILEATDHIGGRMHKTNFAGINVE----
1hyhA1          ------------------IGIIGLGNVGAAVAHGLIAQGVADDYVFIDANEAKVKADQIDFQDAMAN---
1aogA2          ------------------VLTVGGGFISVEFAGIFNAYKPKDGQVTLCYRGEMILRTLREELTKQLTANG
1mo9A2          -----------------TVVVVGGSKTAVEYGCFFNATGRRTVMLVRTEPLKLIKDNETRYVLDRMKEQG
1b73A1          ------------------IGIFDSGVGGLTVLKAIRNRYRKVDIVYLGDTARVPYGIRSKDTIIRYSLEC
1evyA2          ------------------AVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKR-----------
1bncA2          ------------------IVIANRGEIALRILRACKELGIKTVAVHSSADRDL-----------------
1d7yA2          ------------------LLIVGGGVIGLELAATARTAGVHVSLVETQPRLMSRAA-PATLADFVARYH-
1w4xA1          ----------RQPPEEVDVLVVGAGFSGLYALYRLRELGRSVHVIETAGDVGGVWYWNRYPGARCDIESI
1f8gA1          ----------------ARVLVFGVGVAGLQAIATAKRLGA--VVXATDVRAATKEQVESLGGKFITVDD-
1ks9A2          ------------------ITVLGCGALGQLWLTALCKQGHEVQGWLRVPQPYCS----------------
1sr8A           ----------------------------------------------------------------------
1i8tA1          -----------------DYIIVGSGLFGAVCANELKKLNKKVLVIEKRNHIGGNAYTEDCEGIQIHK---
2f5tX1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ITDYTKDTIDGFIRQELARNGYRVDQKKWYKWINNSASTMNWLIDLMEAKGYTTTMEIGYTDTEGVFTAH
1d4cA2          AKLGIEDKKQIMIDDTMKGGRNINDPELVKVLANNSSDSIDWLTSMGADMTDV----------------G
1d4cA3          ----------------------------------------------------------------------
1e7pA2          -----GDNEDLHFMDTVKGSDWGCDQKVARMFVNTAPKAIRELAAWIHKGDRMAIINAQKTTITEEDFRH
1pj5A2          KTMASFAKYTVEKLLSLTEDGVSCFNQVGGLEVATTETRLADLKRKLGYAAAWGIEGRLLSPAECQELYP
2ivdA1          ----------------------------------------------------------------------
1cf3A1          APNAKQIAAGHYFNASCHGVNGTVHAGPRDTGDDYSPIVKALMSA-VEDRGVPTKKDFGCGDPHGVSMFP
2pnwA1          ----------------------------------------------------------------------
1jnrA2          IDLTGRSERQNTLEDYVRYVTLDMMGLAREDLVADYARHVDGTVHLFEKWGL-------------PIWKT
2gqfA1          PAHYLSQNPH-FVKSALAR-------------------YTNWFISLVAEQGITY---------------H
1kdgA1          LTKFDIPGLFESLDSNPFWWCKDITVFAGCLVGGGSSVGWPSSWTNHAPYTSKLSSRLPSTDQRYLEQSF
1vqwA2          IYLKGGKVLSNI----------------------------------------------------------
1el5A1          GREYVPLALQELWYELEKETHHKIFTKTGVLVFGPKGESAFVAETMEAAKEHSLTVDLLEGDEINKRWPG
1p9oA           ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1ng3A1          RDAFFDFAMHSQLGEELYALSGVDIRQHNGGMFKLAFSEEDVLQLRQMDDLDSVS---WYSKEEVLEKEP
2i0zA1          LDEIVKHIPGNGRFLYSAFSIFNNEDIITFFENLGVKLKEEDHGRMFPVSNKAQSVVDALLTRLKDLGVK
1bf3A1          DLLREAGVDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGK----------------------------
1w4xA2          -----KKRYAEFREESRNTPGGTHRYQGPKSALEVSDEELVETLERYWQEGILAAYRDILRDRDANERVA
1sezA1          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1h6vA2          IKFIRQFVPTKIEQIE------------------------------------------------------
1gosA1          S----------YVGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNF
1d7yA1          KIRLDCKRAPEVEWL--LGVTAQSFDPQAHTVALSDGRTLPY----------------------------
1b4vA1          SSWFKNRTEAPLGS--------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1tzlA1          ---KNIDKFVNVIQGQLXSVSVPVNTLVV-----------------------------------------
2culA1          SLLERAYDPKDERVWAFHARAKYLLEGLRPLHLFQATATGLLLEGNRVVGVRTWEGPPARGEK--VVLAV
2vouA1          EQGVELDSISVPSSSMEYVDALTGERVGSVPADWRFTSYDSIYGGLYELFGPERYHTSKCLVGLSQDSET
1onfA2          INIVTFADVVEIKKVSDKNLSIHLSDGR------------------------------------------
1cjcA2          INTFTQTARSDRCAFYGNVEVGRD----------------------------------------------
1djnA3          HRDYRETQITKLLK--------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1vqwA1          STNPILTTEPIVGPAALPVYPSPLYRDLQTNTPI------------------------------------
1f0yA2          AENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNLDKFAAEHTIFASNTSSLQITSI-
1bwcA2          VEVLKFSQVKEVKKTL------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1bhyA1          AVIDEVRHLAANGIKYPEPELDIDMLRAYKDGVVSRLTGGLAGMAKSRKVDVIQGDGQFLDPHHLEVSLT
1uaiA           ----------------------------------------------------------------------
1fohA5          ESLKNLGLADKILSEANDMSTIALYNPDENGHIRRTDRIPDTLPGISRYHQVVHQGRIERHILDSIAEIS
1ltxR1          WQEQILENEEAIPLSSKDKTIQHVEVFCYASQDKNRITYSQIIKEGRRFNIDLVSKLLYSRGLLIDLLIK
1b37A1          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1aogA2          IQILTKENPAKVELNA------------------------------------------------------
1mo9A2          MEIISGSNVTRIEEDA------------------------------------------------------
1b73A1          AGFLKDKGVDIIV---------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1w4xA1          EYCYSFSEEVLQEWNWTERYASQPEILRYINFVADKFDLRSGITF----HTTVTAAAFDEATNTWTVDTN
1f8gA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1sr8A           ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
2f5tX1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PGSHNWVEQADGKESGAATGENLVIAMYEEKIKEQGGQIHYSTIGQYLIREDNNTGRVSAIVAKDPDGNY
1d4cA2          RMGGASVNRSHRPTGGAGVGAH-VAQVLWDNAVKRGTDIRLNSRVVRILEDAS--GKVTGVLVKGEYTG-
1d4cA3          ----------------------------------------------------------------------
1e7pA2          GLIHSRDFGGTKKWTADATGHTMLFAVANECLK-LGVSIQDRKEAIALIHQD---GKCYGAVVRDLVTGD
1pj5A2          LLDGENILGGLHVPSDGLASAARAVQLLIKRTESAGVTYRGSTTVTGIEQSG---GRVTGVQTADGVIPA
2ivdA1          ----------------------------------------------------------------------
1cf3A1          NTLHE----------DQVRSDAAREWLLP-NYQRPNLQVLTGQYVGKVLLSQNGTPRAVGVEFGTHKGNT
2pnwA1          ----------------------------------------------------------------------
1jnrA2          PDGKYVREGQWQIMIHGESYKPIIAEAAKMAVGEENIYERVFIF--ELLKDNNDPNAVAGAVGFSVREPK
2gqfA1          EKELGQLFCDEGAEQ--------IVEXLKSECDKYGAKILLRSEVSQVERIQNDEKVRFVLQV---NSTQ
1kdgA1          NVVSQLLKGQGYNQFLNGKRAGPVATYLQTALARPNFTFKTNVMVSNVVRNGSQILGVQTNDPTLGPNGF
1vqwA2          ----------------------------------------------------------------------
1el5A1          ITVPENYNAIFEPNSGVLFSENCI-RAYRELAEARGAKVLTHTRVEDFDISPD------SVKIETANGSY
1p9oA           ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1ng3A1          YASGDIFGASFIQDDVHVEPYFVCKAYV-KAAKMLGAEIFEHTPVLHVERDGE------ALFIKTPSGDV
2i0zA1          IRTNTPVE--------------------------------------------------------------
1bf3A1          ----------------------------------------------------------------------
1w4xA2          EFIRNKIRNTVRDPEVAERLVPKGYPFGTKRL------ILEIDYYEMFNRDNVHLVDTLSAPIETITPRG
1sezA1          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1gosA1          WRTMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESKQLATLFVNLCVTAETHEVSALWFLWYV
1d7yA1          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1tzlA1          ----------------------------------------------------------------------
2culA1          GSFLGARLFLGGVVEEAGRLSEASYPDLLEDLSRLGFRFVEREGEVPPGYRVRYLAFHPEEWEEKT----
2vouA1          VQMRFS----------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1bhyA1          AGDAYE----------------------------------------------------------------
1uaiA           ----------------------MVFREAFNH-LPEVKPHLVGAQIHDGDDDVTV-FRLEGTSLYITKGDD
1fohA5          DTRIKVERPLIPEKMEIDSSKAEDPEAYPVTMTLRYMSDHESTPLQFGHKTENSLFHSNLQTQEEEDANY
1ltxR1          SNVSRYAEFKNITRILAFREGTVEQVPCSRADVFNSKQLTMVEKRMLFLTFCVEYEEHPDEYR-AYEGTT
1b37A1          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1w4xA1          HGDRIRARYLIMASGQLSDALTGALFKIDIRGVGNVALKEKWAAGPRTYLGLSTAGFPNLFFIA-GPGSP
1f8gA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1sr8A           ----------VCETSGIFFGRGVGVKAGEKAV---------SRSAKLQILENREFNFSGGVRISVPDG--
1i8tA1          ----------------------------------------------------------------------
2f5tX1          -----------------------------------DIRFFAMFHAVDFVKNHLKRNIYAEITGKNLESGR


                         .         *         .         .         .         .         +:350
query           VKYVGRKAIVLATGDFSANQDMMAKYCSWVAPLLQYNEVDYDAMFQFGGLGPGDGQKMGLWVGAAWQQTL
1d4cA2          YYVIKADAVVIAAGGFAKNNERVSKYDPKLKGFKATNHPGAT----------GDGLDVALQAGAATRDLE
1d4cA3          ----------------------------------------------------------------------
1e7pA2          IIAYVAKGTLIATGGYGVCEGTGTAIALETGIAQLGNRTDYRGEAKLKGL--------------------
1pj5A2          ------DIVVSCAGFWGAKIGAMIVPPDGGPLLGESKELDYVAEAVWVTHSAGVAKAMAELLTTGR----
2ivdA1          ----------------------------------------------------------------------
1cf3A1          HNVYAKHEVLLAAGSAVSPTILEYSGIGM-KSILEPLGIDTVVDLPVGLCSMMPKEMGGVVDNAARVYGV
2pnwA1          --------------------------------------------FFETNSVPFRISPSGFVTAVSATPDD
1jnrA2          FYVFKAKAVILATGGATL--------------LFRPRSTGEAARTWYAIFDTGSGYYMGLKAGAMLTQAG
2gqfA1          WQC---KNLIVATGGLS-----------------------------------------------------
1kdgA1          IPVTPKGRVILSAGAFGTSRILFQSGIGPTDMIQTVQSNPTAAAALPPQNQWINLPVGMTTIG-------
1vqwA2          ----------------------------------------------------------------------
1el5A1          T----ADKLIVSMGAWNSKLLSKLNLDIPDEHFIIDLHPEHS----------------------------
1p9oA           ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1ng3A1          WAN----HVVVASGVWS-----------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
1bf3A1          ----------------------------------------------------------------------
1w4xA2          VRTSERDSLVLATG--------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1gosA1          KQCGGTTRIISTTNGGQERKFVG----GSGQVSERIMDLLGDRVKLERPVIYIDQTRENVLVETLNHEMY
1d7yA1          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1tzlA1          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1bhyA1          ----------------------------------------------------------------------
1uaiA           THHKLVTSDYKLNTVFEGKFVVSG----------------------------------------------
1fohA5          RLPEGKEAGEIETVHCKYVIGCDGGHSWVRRTLGFEMIVTEKFSKDERVFIAGD----------------
1ltxR1          FSEYLKTQKLTPNLQYFVLHSIAMTSTSCTVDGLKATKKFLQCLGRYGNTPFLFPLYGQGELPQCFCRMC
1b37A1          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1w4xA1          SALSNMLVSIEQHVEWVTDHIAYMFKN-GLTRSEAVLEKEDEWVEHVNEIADETLYPMTASWYTGANVPG
1f8gA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1sr8A           ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
2f5tX1          LETLTGRVVGYTLSLREAVNNIHL--------------------------ETENGVVKVGGMFAV-----


                         .         .         .         .         *         .         .:420
query           PNAPMIDAVGPMPYRQSIADFSGLLLNKKGERYSNEDVIFSYGTYAMMMQPDMTRYGIWDTAYANWFDTW
1d4cA2          MGGLVIGKPITGLYAAGEVTGGVHGANRLGGNAISDIVTYGRIAGASA----------------------
1d4cA3          ----------------------AIVVNREGNRFMNEITTRDKASAAILQQKGESAYLVFDDSIRKSLKAI
1e7pA2          ----------------------------------------------------------------------
1pj5A2          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1cf3A1          QGLRVIDG--------------------------------------------------------------
2pnwA1          VWRYPIYRRPPELVDIDNDNRPDGFDPSYAFGKADEEGISYFPDRRAIDEGCLRGRGLEIAWARSFFVHV
1jnrA2          FWVCGPEDLMPEEY--------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1kdgA1          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1ng3A1          ----------------------------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
1bf3A1          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1gosA1          EAKYVISAIPPTL---------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1tzlA1          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1bhyA1          ----------------------------------------------------------------------
1uaiA           ----------------------------------------------------------------------
1fohA5          ----------------------------------------------------------------------
1ltxR1          AVFGGIYCLRHSVQCLVVDKESRKCKAVIDQFGQRIISKHFIIEDSYLSENTCSRVSRDCYNDLPSNVYV
1b37A1          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1w4xA1          KPRVFMLYVGGFHRYR-QICDEVAAKGYEG----------------------------------------
1f8gA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1sr8A           ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
2f5tX1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ETFGTTIVENEGKNATTPEGYLASWDSNVEKGTFVKGDTIEEVIAQLDGLDPENAKKSVERYNELCEAKY
1d4cA2          ----------------------------------------------------------------------
1d4cA3          EGY-------------------------VHLNIVKEGKTIEE-LAKQIDVPAAELAKTVTAYNGFVKSGK
1e7pA2          ----------------------------------------------------------------------
1pj5A2          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1cf3A1          ----------------------------------------------------------------------
2pnwA1          QGAARLVFPDGAIKRITYAAK-AGHVFSPIGRLLLDRGELDPKTISMQT-IRQWLADHPDEVDGVLWHNR
1jnrA2          ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1kdgA1          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1ng3A1          ----------------------------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
1bf3A1          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1tzlA1          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1bhyA1          ----------------------------------------------------------------------
1uaiA           ----------------------------------------------------------------------
1fohA5          ----------------------------------------------------------------------
1ltxR1          CSGPDSGLGN------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1w4xA1          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1sr8A           ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
2f5tX1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DDDFHKSATLLAPIKEGPFYGCKLEMSPANFLCVTGGLRTNENMQVCDEQNEPIEGLYxxxxxxxxxxxx
1d4cA2          ----------------------------------------------------------------------
1d4cA3          DAQFERP-DLPRELVVAPFYA--LEIAPA-----------------------------------------
1e7pA2          ----------------------------------------------------------------------
1pj5A2          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1cf3A1          ----------------------------------------------------------------------
2pnwA1          SYIFFRGPIAAAKVPLVAGRALA--VDRLIHTF-GLPFFIHAPTLTHLDDGKPFARLM------------
1jnrA2          ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1kdgA1          ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1ng3A1          ----------------------------------------------------------------------
2i0zA1          ----------------------------------------------------------------------
1bf3A1          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1b4vA1          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1tzlA1          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
2vouA1          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1vqwA1          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1bhyA1          ----------------------------------------------------------------------
1uaiA           ----------------------------------------------------------------------
1fohA5          ----------------------------------------------------------------------
1ltxR1          ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1b73A1          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1w4xA1          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1sr8A           ----------------------------------------------------------------------
1i8tA1          ----------------------------------------------------------------------
2f5tX1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1d4cA2          -----------------------------
1d4cA3          -----------------------------
1e7pA2          -----------------------------
1pj5A2          -----------------------------
2ivdA1          -----------------------------
1cf3A1          -----------------------------
2pnwA1          -----------------------------
1jnrA2          -----------------------------
2gqfA1          -----------------------------
1kdgA1          -----------------------------
1vqwA2          -----------------------------
1el5A1          -----------------------------
1p9oA           -----------------------------
1f8rA1          -----------------------------
1ng3A1          -----------------------------
2i0zA1          -----------------------------
1bf3A1          -----------------------------
1w4xA2          -----------------------------
1sezA1          -----------------------------
1an9A1          -----------------------------
1h6vA2          -----------------------------
1gosA1          -----------------------------
1d7yA1          -----------------------------
1b4vA1          -----------------------------
1dxlA2          -----------------------------
2dw4A2          -----------------------------
1tzlA1          -----------------------------
2culA1          -----------------------------
2vouA1          -----------------------------
1onfA2          -----------------------------
1cjcA2          -----------------------------
1djnA3          -----------------------------
1lnqA3          -----------------------------
1gt8A4          -----------------------------
1vqwA1          -----------------------------
1f0yA2          -----------------------------
1bwcA2          -----------------------------
1b6rA2          -----------------------------
1f8wA1          -----------------------------
1bhyA1          -----------------------------
1uaiA           -----------------------------
1fohA5          -----------------------------
1ltxR1          -----------------------------
1b37A1          -----------------------------
1hyhA1          -----------------------------
1aogA2          -----------------------------
1mo9A2          -----------------------------
1b73A1          -----------------------------
1evyA2          -----------------------------
1bncA2          -----------------------------
1d7yA2          -----------------------------
1w4xA1          -----------------------------
1f8gA1          -----------------------------
1ks9A2          -----------------------------
1sr8A           -----------------------------
1i8tA1          -----------------------------
2f5tX1          -----------------------------