[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV54398.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1t5dX.bssp"
#ERROR : Can't open dsspfile "1md9A.bssp"
#ERROR : Can't open dsspfile "1pg3A.bssp"
#ERROR : Can't open dsspfile "1hf2A1.bssp"
#ERROR : Can't open dsspfile "1wmxA.bssp"
#ERROR : Can't open dsspfile "1amuA.bssp"
#ERROR : Can't open dsspfile "1o65A.bssp"
#ERROR : Can't open dsspfile "1qhbA.bssp"

## Summary of PDB Search
:447
    6e-16  18%  1t5dX  [e.23.1.1] 4-CHLOROBENZOYL COA LIGASE
    5e-10  16%  1md9A  [e.23.1.1] 2,3-DIHYDROXYBENZOATE-AMP LIGASE
    1e-08  12%  1pg3A  [e.23.1.1] ACETYL-COA SYNTHETASE
    7e-07   8%  1hf2A1 [b.80.3.1] SEPTUM SITE-DETERMINING PROTEIN MINC A:100 -- 206
    3e-04   7%  1wmxA  [b.18.1.24] COG3291: FOG: PKD REPEAT
    3e-04  18%  1amuA  [e.23.1.1] GRAMICIDIN SYNTHETASE 1
    4e-04   7%  1o65A  [b.58.1.2] HYPOTHETICAL PROTEIN YIIM
    6e-04  11%  1qhbA  [a.111.1.2] HALOPEROXIDASE
:447

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxDPEIECMPRPELEALQLERLKDMVAYAYDNTVYYKRAFDEAGVKPGDIESLDDIAKFP
1t5dX           ----------------------------------------------------------------------
1md9A           ----------------------------------------------------------------------
1pg3A           ------------DEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDLIEKA
1hf2A1          ----------------------------------------------------------------------
1wmxA           ----------------------------------------------------------------------
1amuA           ----------------------------------------------------------------------
1o65A           ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FCDKKTERETQHVGSFFGEMCSVPEEEVIFMAXXXXXXXXXXXXXFTQEDFDLWQDTEARLFWQAGMRPN
1t5dX           --------------------------------------------------------------VGLRHGRH
1md9A           ----------------------------------------------------------KRSVEVCWLDHS
1pg3A           --------------SPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVY--AATTFKYVFDYHPG
1hf2A1          ----------------------------------------------------------------------
1wmxA           ----------------------------------------------------------------------
1amuA           -----------------------------------------------------------------NVTEK
1o65A           ----------------------------------------------------------------------
1qhbA           -----------------------------------------------------TKGLPHDDNGAIIDPDD


                         +         .         .         .         .         *         .:210
query           DRYVHGLNFALYVGGPDVIGAQRLGALAIWVGAVPSDRLLFVLKQYQPTIIWTSPSYAWHLGEIAKEKGF
1t5dX           NVVLGLMPLYHVVGFFAVVAALALDGTYVVVEEFRPVDALQLVQQEQVTSLFATPTHLDALAAAAAH-AG
1md9A           TVYLAALPXAHNYPSPGVLGVLYAGGRVVLSPSPSPDDAFPLIEREKVTITALVPPLAXVWXDAASSRRD
1pg3A           DIYWCTADVGWVTGYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKA-I
1hf2A1          ----------------------------------------------------------------------
1wmxA           ----------------------------------------------------------------------
1amuA           DRIGQFASISFDASVWEMFMALLTGASLYIILKDTIVKFEQYINQKEITVITLPPTYVVH---------L
1o65A           ----------------------------------------------------------------------
1qhbA           FLAFVRAINS---GDEKEIAALTLGPARDPETGLPIWRSD-LANSLDLEV---RGWENSSAGLTFDLEGP


                         .         .         .         +         .         .         .:280
query           DPKEDFNIHTIIVAGEAGGSIKSTREAIENLWGAKVVDFYGLSDIYGACAAACEAHDGLHIVEDQILVET
1t5dX           SSLKLDSLRHVTFAGAT--MPDAVLETVHQHLPGEKVNIYGTTEAMNSLYMPKTGTEMAPGFFSEVRIVR
1md9A           DLS---SLQVLQVGGAKFS--AEAARRVKAVFGCTLQQVFGXAEGLVNYTRLDDPEEIIVKPXSPYDESR
1pg3A           EGTDRSSLRILGSVGEPI--NPEAWEWYWKKIGKEKCPVVDTWWQTETGGFMITPLPGSATRPFFGVQPA
1hf2A1          ----------------------------------------------------------------------
1wmxA           ----------------------------------------------------------------------
1amuA           DPERILSIQTLITAGSAT--SPSLVNKWKEKVTYINAYGPTETTICATTWVATKETIGHSVPIGAPIQNT
1o65A           -------------------------------------------------------------------VER
1qhbA           DA-QSVAMP----PAPVLTSPELIAEMAELYLMALGRDIEFSEFDSPKNAAFIRSAIERLNGLEWFNTPA


                         .         *         .         .         .         .         +:350
query           VDPTTGEVLAPGETGELVYTTLCKKARPMIRFRTGDIGYVSTDTCECGRTLARIHVTGRKDEMFIVGAVN
1t5dX           IGGGVDEIVANGEEGELIVAASDSAFVGYLNQPQATDGWYRTSDVAVWTPEGTVRILGRVDDMIISGGEN
1md9A           VWDDHDRDVKPGETGHLLRGYYKAEEHNAASFTED--GFYRTGDIVRLTRDGYIVVEGRAKDQINRGGEK
1pg3A           LVDNEGHPQEGATEGNLVITDSWPGQARTLFGDHERYFSTFKNMYFSGDGARRYWITGRVDDVLNVSGHR
1hf2A1          ---TGKVIKRNIRSGQTVVHS----GDVIVFGNVNKGAEILAGFGKAQGNIRAGLN-EGGQAVVAALDLQ
1wmxA           SGMGELETIGDTLPVDTTVTGWWISLLTLRGWNTHDLSQYVENGYLEFDIK---GKEGGEDFVIGFRDKV
1amuA           IVDENLQLKSVGEAGELCYWKRPELTSQKFVDNPFVPGEKLYKTGDQARWLSDIEYLGRIDNQVKIRGHR
1o65A           EQMRYPVDVYTGKAKIQVDGELRALCHYPREHYLYWAREFPEQAELFVAPAFLSTDGLTESNVYMGDIFR
1qhbA           KLGDPP-------AEIRRRR---GEVTVGNLF--RGILPGSEVGPYLSQFIIVGS---------------


                         .         .         .         .         *         .         .:420
query           VFPSDIEYVVRGLDGLTGEYSIRVYEKNFTCKYEVSVERSLGSDEPYDEVASRTEAALKAHTGVRPAKVI
1t5dX           IHPSEIERVLGTAPG-------------------------------------------------------
1md9A           VAAEEVENHLLAHPA-------------------------------------------------------
1pg3A           LGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPATPDVLH
1hf2A1          TSLIQIAGFITHSKGEENVPSIAHVK--------------------------------------------
1wmxA           YERVYGLEIDVTTVI-------------------------------------------------------
1amuA           VELEEVESILLKHMY-------------------------------------------------------
1o65A           WGEALIQVSQP-----------------------------------------------------------
1qhbA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VYDAGKLGTSxxxxxxxxxxxxxxxxx
1t5dX           ---------------------------
1md9A           ---------------------------
1pg3A           WTDSLPKTRS-----------------
1hf2A1          ---------------------------
1wmxA           ---------------------------
1amuA           ---------------------------
1o65A           ---------------------------
1qhbA           ---------------------------