[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV54491.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1h0mA1.bssp"
#ERROR : Can't open dsspfile "1yioA1.bssp"
#ERROR : Can't open dsspfile "1fseA.bssp"
#ERROR : Can't open dsspfile "1iw7F2.bssp"
#ERROR : Can't open dsspfile "1p4wA.bssp"
#ERROR : Can't open dsspfile "1resA.bssp"
#ERROR : Can't open dsspfile "1tc3C.bssp"
#ERROR : Can't open dsspfile "1a04A1.bssp"
#ERROR : Can't open dsspfile "1k78A1.bssp"
#ERROR : Can't open dsspfile "1y0uA.bssp"
#ERROR : Can't open dsspfile "1fseF.bssp"
#ERROR : Can't open dsspfile "1jhgA.bssp"
#ERROR : Can't open dsspfile "1rp3A2.bssp"
#ERROR : Can't open dsspfile "2dk5A1.bssp"
#ERROR : Can't open dsspfile "1p6rA.bssp"
#ERROR : Can't open dsspfile "1or7A1.bssp"
#ERROR : Can't open dsspfile "1ku3A.bssp"
#ERROR : Can't open dsspfile "1hcrA.bssp"
#ERROR : Can't open dsspfile "1dpuA.bssp"
#ERROR : Can't open dsspfile "1vz0A1.bssp"
#ERROR : Can't open dsspfile "1a9xA1.bssp"

## Summary of PDB Search
:519
    1e-12  25%  1h0mA1 [a.4.6.2] TRANSCRIPTIONAL ACTIVATOR PROTEIN TRAR A:170 --
    9e-12  40%  1yioA1 [a.4.6.2] RESPONSE REGULATORY PROTEIN A:131 -- 200
    1e-11  29%  1fseA  [a.4.6.2] GERE
    1e-10  18%  1iw7F2 [a.4.13.2] RNA POLYMERASE SIGMA-70 SUBUNIT F:319 -- 423
    3e-10  28%  1p4wA  [a.4.6.2] RCSB
    7e-10  22%  1resA  [a.4.1.2] GAMMA DELTA-RESOLVASE
    7e-09   9%  1tc3C  [a.4.1.2] PROTEIN (TC3 TRANSPOSASE)
    1e-08  43%  1a04A1 [a.4.6.2] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN NARL
    1e-07  20%  1k78A1 [a.4.1.5] PAIRED BOX PROTEIN PAX5 A:19 -- 81
    6e-07  21%  1y0uA  [a.4.5.5] ARSENICAL RESISTANCE OPERON REPRESSOR, PUTATIVE
    1e-06  14%  1fseF  [a.4.6.2] GERE
    4e-06  16%  1jhgA  [a.4.12.1] TRP OPERON REPRESSOR
    5e-06  16%  1rp3A2 [a.4.13.2] RNA POLYMERASE SIGMA FACTOR SIGMA-28 (FLIA) A:164
    5e-06  10%  2dk5A1 [a.4.5.85] DNA-DIRECTED RNA POLYMERASE III 39 KDA A:8 -- 85
    6e-06  17%  1p6rA  [a.4.5.39] PENICILLINASE REPRESSOR
    1e-05  14%  1or7A1 [a.4.13.2] RNA POLYMERASE SIGMA-E FACTOR A:120 -- 187
    1e-05  18%  1ku3A  [a.4.13.2] SIGMA FACTOR SIGA
    5e-05  28%  1hcrA  [a.4.1.2] PROTEIN (HIN RECOMBINASE)
    6e-05  17%  1dpuA  [a.4.5.16] REPLICATION PROTEIN A (RPA32) C-TERMINAL DOMAIN
    1e-04  32%  1vz0A1 [a.4.14.1] CHROMOSOME PARTITIONING PROTEIN PARB A:116 -- 208
    7e-04  14%  1a9xA1 [a.92.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN)
:519

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1h0mA1          ----------------------------------------------------------------------
1yioA1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1rp3A2          ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1ku3A           ----------------------------------------------------------------------
1hcrA           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
1vz0A1          ----------------------------------------------------------------------
1a9xA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1h0mA1          ----------------------------------------------------------------------
1yioA1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1rp3A2          ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1ku3A           ----------------------------------------------------------------------
1hcrA           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
1vz0A1          ----------------------------------------------------------------------
1a9xA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1h0mA1          ----------------------------------------------------------------------
1yioA1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1rp3A2          ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1ku3A           ----------------------------------------------------------------------
1hcrA           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
1vz0A1          ----------------------------------------------------------------------
1a9xA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1h0mA1          ----------------------------------------------------------------------
1yioA1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1rp3A2          ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1ku3A           ----------------------------------------------------------------------
1hcrA           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
1vz0A1          ----------------------------------------------------------------------
1a9xA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1h0mA1          ----------------------------------------------------------------------
1yioA1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1rp3A2          ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1ku3A           ----------------------------------------------------------------------
1hcrA           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
1vz0A1          ----------------------------------------------------------------------
1a9xA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1h0mA1          ----------------------------------------------------------------------
1yioA1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1rp3A2          ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1ku3A           ----------------------------------------------------------------------
1hcrA           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
1vz0A1          ----------------------------------------------------------------------
1a9xA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxPGPDAPDVHDALPHANKLQNACHALTDQYQLTGREEEILVLLARGRTAQHIADTLVITQSTAKTHL
1h0mA1          ------------------------------DAAWLDPKEATYLRWIAVGKTXEEIADVEGVKYNSVRVKL
1yioA1          ---------------------------------SLTGREQQVLQLTIRGLMNKQIAGELGIAEVTVKVHR
1fseA           ---------------------------------LLTKREREVFELLVQDKTTKEIASELFISEKTVRNHI
1iw7F2          ----PDEHLPSPVDAATQSLLSEELEKALS---KLSEREAMVLKLRKGLIDGEEVGAFFGVTRERIRQIE
1p4wA           ---------------------------------RLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQK
1resA           ---------------------------------KRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVI
1tc3C           ---------------------------------ALSDTEAQLDVMKLLNVSLHEMSRKISRSRHCIRVYL
1a04A1          ---------------------------------QLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHV
1k78A1          ---------------------------------PLPDVVRQRIVELAQGVRPCDISRQLRVSHGCVSKIL
1y0uA           ----------------------------------TNPVRRKILRXLDKGRSEEEIXQTLSLSKKQLDYHL
1fseF           ------------------------------------------------LLTKREREVFELLVQDKVRNHI
1jhgA           ---------------------------------ALGTRVRIIEELLRGEMSQRELKNELGAGIATITRGS
1rp3A2          ---------------------------------KLPEREKLVIQLIFYELPAKEVAKILETSVSRVSQLK
2dk5A1          ---------------------------------GSDNQEKLVYQIIEKGIWSRDVRYKSNLPLTEINKIL
1p6rA           -------------------------------IPQISDAELEVMKVIWKNEVIKELSKTSTWSPKTIQTML
1or7A1          -------------NLMLSEELRQIVFRTI---ESLPEDLRMAITLREDGLSYEEIAAIMDCPVGTVRSRI
1ku3A           ---------------------------------KLSEREAMVLKMDGREHTLEEVGAYFGVTRERIRQIE
1hcrA           -------------------------------------EQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYF
1dpuA           --------------------------------NGLTVAQNQVLNLIKAGLNFQDLKNQLHMSVSSIKQAV
1vz0A1          ---------------------------------DLSPVEEGYQALLEMGLTQEEVARRVGKARSTVANAL
1a9xA1          ---------RWFLVQIEELVRLEEKVA----EVGITGLNADFLRQLRKGFADARLAKLAGVREAEIRKLR


                         *         .         .         .         .         +         .:560
query           RNIYAKMDVHNQQEILNLVEQxxxxxxxx
1h0mA1          REAXKRFDVRSKAHLTALAIR--------
1yioA1          HNIMQKLNVRSLANLVHLVEK--------
1fseA           SNAMQKLGVKGRSQAVVELLR--------
1iw7F2          NKALRKLKYHESRTRK-------------
1p4wA           KSAMMKLGVDNDIALLNYLSS--------
1resA           NES--------------------------
1tc3C           KDPVSYG----------------------
1a04A1          KHMLKKMKLKSRVE---------------
1k78A1          GRYYETGSI--------------------
1y0uA           KVLEAGFCIERVGERWVVTDA--------
1fseF           SNAMQKLGVKGRSQAVVELLR--------
1jhgA           NSL-KAAPVELRQWLEEVLLK--------
1rp3A2          AKALERLREMLS-----------------
2dk5A1          KN---------------------------
1p6rA           LRLIKKGALNHHKE---------------
1or7A1          FRAREAIDNKVQ-----------------
1ku3A           NKALRKL----------------------
1hcrA           PASSIK-----------------------
1dpuA           DFLSNEGHIYSTVD---------------
1vz0A1          R----------------------------
1a9xA1          D----QYDLH-------------------