[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV54505.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1yioA1.bssp"
#ERROR : Can't open dsspfile "1fseA.bssp"
#ERROR : Can't open dsspfile "1h0mA1.bssp"
#ERROR : Can't open dsspfile "1iw7F2.bssp"
#ERROR : Can't open dsspfile "1resA.bssp"
#ERROR : Can't open dsspfile "1p4wA.bssp"
#ERROR : Can't open dsspfile "1a04A1.bssp"
#ERROR : Can't open dsspfile "1tc3C.bssp"
#ERROR : Can't open dsspfile "1jhgA.bssp"
#ERROR : Can't open dsspfile "1fseF.bssp"
#ERROR : Can't open dsspfile "1y0uA.bssp"
#ERROR : Can't open dsspfile "1k78A1.bssp"
#ERROR : Can't open dsspfile "2dk5A1.bssp"
#ERROR : Can't open dsspfile "1or7A1.bssp"
#ERROR : Can't open dsspfile "1p6rA.bssp"

## Summary of PDB Search
:520
    1e-10  29%  1yioA1 [a.4.6.2] RESPONSE REGULATORY PROTEIN A:131 -- 200
    1e-10  30%  1fseA  [a.4.6.2] GERE
    2e-10  27%  1h0mA1 [a.4.6.2] TRANSCRIPTIONAL ACTIVATOR PROTEIN TRAR A:170 --
    2e-09  13%  1iw7F2 [a.4.13.2] RNA POLYMERASE SIGMA-70 SUBUNIT F:319 -- 423
    5e-09  15%  1resA  [a.4.1.2] GAMMA DELTA-RESOLVASE
    5e-09  29%  1p4wA  [a.4.6.2] RCSB
    5e-08  31%  1a04A1 [a.4.6.2] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN NARL
    4e-07  20%  1tc3C  [a.4.1.2] PROTEIN (TC3 TRANSPOSASE)
    7e-07  16%  1jhgA  [a.4.12.1] TRP OPERON REPRESSOR
    8e-06  18%  1fseF  [a.4.6.2] GERE
    1e-05  19%  1y0uA  [a.4.5.5] ARSENICAL RESISTANCE OPERON REPRESSOR, PUTATIVE
    4e-05  26%  1k78A1 [a.4.1.5] PAIRED BOX PROTEIN PAX5 A:19 -- 81
    1e-04  12%  2dk5A1 [a.4.5.85] DNA-DIRECTED RNA POLYMERASE III 39 KDA A:8 -- 85
    1e-04  17%  1or7A1 [a.4.13.2] RNA POLYMERASE SIGMA-E FACTOR A:120 -- 187
    2e-04  17%  1p6rA  [a.4.5.39] PENICILLINASE REPRESSOR
:520

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1yioA1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1h0mA1          ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1yioA1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1h0mA1          ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1yioA1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1h0mA1          ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1yioA1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1h0mA1          ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1yioA1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1h0mA1          ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1yioA1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1h0mA1          ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxDLALVERFADEYGLTPRERELLGFFAQGYSVAYASEQLVLS
1yioA1          ------------------------------------------LTGREQQVLQLTIRGLMNKQIAGELGIA
1fseA           ------------------------------------------LTKREREVFELLVQDKTTKEIASELFIS
1h0mA1          --------------------------------------DAAWLDPKEATYLRWIAVGKTXEEIADVEGVK
1iw7F2          ------------------------------------------LSEREAMVLKLRKGLIDGEEVGAFFGVT
1resA           ------------------------------------------RKIDRDAVLNMWQQGLGASHISKTMNIA
1p4wA           ------------------------------------------LSPKESEVLRLFAEGFLVTEIAKKLNRS
1a04A1          ------------------------------------------LTPRERDILKLIAQGLPNKMIARRLDIT
1tc3C           ------------------------------------------LSDTERQLDVMKLLNVSLHEMSRKISRS
1jhgA           ------------------------------------------LGTRVRIIEELLRGEMSQRELKNELGAG
1fseF           --------------------------------------------------------LLTKREREVFELLV
1y0uA           ------------------------------------------TNPVRRKILRXLDKGRSEEEIXQTLSLS
1k78A1          ------------------------------------------LPDVVRQIVELAHQGVRPCDISRQLRVS
2dk5A1          -----------------------------DSQNAGKMKG---SDNQEKLVYQIIEDGIWSRDVRYKSNLP
1or7A1          ------------------------------------------LPEDLRMITLRELDGLSYEEIAAIMDCP
1p6rA           ----------------------------------------PQISDAELEVMSSINTNEVIKELSKTSTWS


                         *         .         .         .         .         +         .:560
query           PYTVRTHLRNIYVKTDTHSRDDLLALLKTY
1yioA1          EVTVKVHRHNIMQKLNVRSLANLVHLVEKY
1fseA           EKTVRNHISNAMQKLGVKGRSQAVVELL--
1h0mA1          YNSVRVKLREAXKRFDVRSKAHLTALAI--
1iw7F2          RERIRQIENKALRKLKYHESRTRKLR----
1resA           RSTVYKVINES-------------------
1p4wA           IKTISSQKKSAMMKLGVDNDIALLNYLS--
1a04A1          ESTVKVHVKHMLKKMKLKSRVEAAVW----
1tc3C           RHCIRVYLKDPVSYGTS-------------
1jhgA           IATITRGSNSLK-AAPVELRQWLEEVLL--
1fseF           QDKVRNHISNAMQKLGVKGRSQAVVE----
1y0uA           KKQLDYHLKVLEAGFCIERVGERWVV----
1k78A1          HGCVSKILGRYYET----------------
2dk5A1          LTEINKILKN--------------------
1or7A1          VGTVRSRIFRAREAIDNKVQ----------
1p6rA           PKTIQTMLLRLIKKGALNHHKEG-------