[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV54563.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1h0mA1.bssp"
#ERROR : Can't open dsspfile "1fseA.bssp"
#ERROR : Can't open dsspfile "1yioA1.bssp"
#ERROR : Can't open dsspfile "1a04A1.bssp"
#ERROR : Can't open dsspfile "1p4wA.bssp"
#ERROR : Can't open dsspfile "1iw7F2.bssp"
#ERROR : Can't open dsspfile "1jhgA.bssp"
#ERROR : Can't open dsspfile "1y0uA.bssp"
#ERROR : Can't open dsspfile "1rp3A2.bssp"
#ERROR : Can't open dsspfile "1p6rA.bssp"
#ERROR : Can't open dsspfile "1resA.bssp"
#ERROR : Can't open dsspfile "1tc3C.bssp"
#ERROR : Can't open dsspfile "1dpuA.bssp"
#ERROR : Can't open dsspfile "1fseF.bssp"
#ERROR : Can't open dsspfile "1k78A1.bssp"
#ERROR : Can't open dsspfile "1or7A1.bssp"
#ERROR : Can't open dsspfile "1ku3A.bssp"
#ERROR : Can't open dsspfile "2dk5A1.bssp"
#ERROR : Can't open dsspfile "1hcrA.bssp"

## Summary of PDB Search
:474
    2e-11  18%  1h0mA1 [a.4.6.2] TRANSCRIPTIONAL ACTIVATOR PROTEIN TRAR A:170 --
    4e-10  35%  1fseA  [a.4.6.2] GERE
    8e-10  37%  1yioA1 [a.4.6.2] RESPONSE REGULATORY PROTEIN A:131 -- 200
    8e-10  33%  1a04A1 [a.4.6.2] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN NARL
    1e-09  31%  1p4wA  [a.4.6.2] RCSB
    1e-08  23%  1iw7F2 [a.4.13.2] RNA POLYMERASE SIGMA-70 SUBUNIT F:319 -- 423
    5e-08  18%  1jhgA  [a.4.12.1] TRP OPERON REPRESSOR
    7e-08  12%  1y0uA  [a.4.5.5] ARSENICAL RESISTANCE OPERON REPRESSOR, PUTATIVE
    5e-07  19%  1rp3A2 [a.4.13.2] RNA POLYMERASE SIGMA FACTOR SIGMA-28 (FLIA) A:164
    7e-07  17%  1p6rA  [a.4.5.39] PENICILLINASE REPRESSOR
    3e-06  23%  1resA  [a.4.1.2] GAMMA DELTA-RESOLVASE
    7e-06   9%  1tc3C  [a.4.1.2] PROTEIN (TC3 TRANSPOSASE)
    2e-05  17%  1dpuA  [a.4.5.16] REPLICATION PROTEIN A (RPA32) C-TERMINAL DOMAIN
    4e-05  21%  1fseF  [a.4.6.2] GERE
    6e-05  18%  1k78A1 [a.4.1.5] PAIRED BOX PROTEIN PAX5 A:19 -- 81
    1e-04  14%  1or7A1 [a.4.13.2] RNA POLYMERASE SIGMA-E FACTOR A:120 -- 187
    4e-04  28%  1ku3A  [a.4.13.2] SIGMA FACTOR SIGA
    5e-04   9%  2dk5A1 [a.4.5.85] DNA-DIRECTED RNA POLYMERASE III 39 KDA A:8 -- 85
    8e-04  12%  1hcrA  [a.4.1.2] PROTEIN (HIN RECOMBINASE)
:474

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1h0mA1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1yioA1          ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1rp3A2          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1ku3A           ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1hcrA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1h0mA1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1yioA1          ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1rp3A2          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1ku3A           ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1hcrA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1h0mA1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1yioA1          ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1rp3A2          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1ku3A           ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1hcrA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1h0mA1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1yioA1          ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1rp3A2          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1ku3A           ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1hcrA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1h0mA1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1yioA1          ----------------------------------------------------------------------
1a04A1          ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1iw7F2          ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1rp3A2          ----------------------------------------------------------------------
1p6rA           ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1dpuA           ----------------------------------------------------------------------
1fseF           ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
1ku3A           ----------------------------------------------------------------------
2dk5A1          ----------------------------------------------------------------------
1hcrA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAPAERERESTPAAAAHALAERYGLTAREAE
1h0mA1          -----------------------------------------------------------DAAWLDPKEAT
1fseA           ---------------------------------------------------------------LTKRERE
1yioA1          ---------------------------------------------------------------LTGREQQ
1a04A1          ---------------------------------------------------------------LTPRERD
1p4wA           -------------------------------------------------TPESVAKLLEKIKRLSPKESE
1iw7F2          ---------------------------------------------------------------LSEREAM
1jhgA           ---------------------------------------------------------------LGTRVRI
1y0uA           ----------------------------------------EEWIKADSLEKADEYHKRYNYAVTNPVRRK
1rp3A2          -----------------------------------------VEEEIKRELTEKVKEAVSK---LPEREKL
1p6rA           ---------------------------------------------------------MKKIPQISDAELE
1resA           ---------------------------------------------------------------RKIDRDA
1tc3C           ---------------------------------------------------------------LSDTEAQ
1dpuA           -------------------------------------------------------------NGLTVAQNQ
1fseF           ----------------------------------------------------------------------
1k78A1          ---------------------------------------------------------------LPDVVRQ
1or7A1          ----------------------------------------MLSEELRQIVFRTIES-------LPEDLRM
1ku3A           ---------------------------------------------------------------LSEREAM
2dk5A1          --------------------------------------------------------QNAGKMGSDNQEKL
1hcrA           -----------------------------------------------------------------HEQEQ


                         .         .         +         .         .         .         .:490
query           VLELVAQGRNMTYVQKALCISPGTSSTHINHIHQKLDVHSREELIDLVQEELxx
1h0mA1          YLRWIAVGKTXEEIADVEGVKYNSVRVKLREAXKRFDVRSKAHLTALAIR----
1fseA           VFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLR----
1yioA1          VLQLTIRGLMNKQIAGELGIAEVTVKVHRHNIMQKLNVRSLANLVHLVEK----
1a04A1          ILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQ----
1p4wA           VLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVDNDIALLNYLSS----
1iw7F2          VLKLRKGLIDGEEVGAFFGVTRERIRQIENKALRKLKYHESRTRK---------
1jhgA           IEELLRGEMSQRELKNELGAGIATITRGSNSL-KAAPVELRQWLEEVLLK----
1y0uA           ILRXLDKGRSEEEIXQTLSLSKKQLDYHLKVLEAGFCIERVGERWVV-------
1rp3A2          VIQLIFEELPAKEVAKILETSVSRVSQLKAKALERLREMLS-------------
1p6rA           VMKVIWKNEVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEGRVFVYTPN--
1resA           VLNMWQQGLGASHISKTMNIARSTVYKVINES----------------------
1tc3C           LDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVSYG------------------
1dpuA           VLNLIKAPRPEGLNFQDLKMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTD---
1fseF           -----------------ELLVQDKVRNHISNAMQKLGVKGRSQAVVELLR----
1k78A1          RIVELAQGVRPCDISRQLRVSHGCVSKILGRYYETGSI----------------
1or7A1          AITLREDGLSYEEIAAIMDCPVGTVRSRIFRAREAIDNKVQ-------------
1ku3A           VLKMLIDGREHTLEEAYFGVTRERIRQIENKALRKL------------------
2dk5A1          VYQIIEDNKGIWSRDYKSNLPLTEINKIL-------------------------
1hcrA           ISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKK------------------