[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV54634.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2o3iA1.bssp"

## Summary of PDB Search
:367
    1e-23  23%  2o3iA1 [e.73.1.1] HYPOTHETICAL PROTEIN A:2 -- 390
:367

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2o3iA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxRYYGKPIYATMPIEAGGVNSMLPIAAAARLGIPMVDVDGMGRAFPELQMVTF
2o3iA1          ------------------ESQGRKLAYVVAPESGALGFVVASLVAAKLGLAVVDADGAGRAVPSLPXLTY


                         +         .         .         .         .         *         .:210
query           TIGGASATPMAFIDEKGNSGILDTITNKWTEDIARAATMTMGGTLTVALFCMDVDTCKQYGVHGIVTRSE
2o3iA1          AAAGVPPTPAFLAGESGLCVDREDISTVVEQXLRPILTNPQFGQGLAXWXXSPAQLGGALPVRGTLSRAL


                         .         .         .         +         .         .         .:280
query           ELGRAIRTAKDEAAAAGLTPEEFFLKFTGGHKLFKGKISDVLRETRGAFNFGRVVLEGIGEDRGSQAFVD
2o3iA1          KLGRALQDGK-----------------VKAXLDFLRRELDIKGKLLFGPATLASPGKVVLEDGERRCTVL


                         .         *         .         .         .         .         +:350
query           FQNENLSCVVDGQIKATVPDLICLVDPDTFTPVPTDALKYGKRVLAVGLECFHLWRTQAGLDLVGPRYFG
2o3iA1          YQNESLLAWDSAHPLATAPDAISYFVEGEGQHVFSNGDLSGNDHGLDPS---VRGRKAAGLILQSFADLG


                         .         .         .         .         *         .         .:420
query           IDTDYIPVExxxxxxxx
2o3iA1          YLGPYAPVD--------