[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV54981.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1p2fA2.bssp"
#ERROR : Can't open dsspfile "1a0oA.bssp"
#ERROR : Can't open dsspfile "1ys6A1.bssp"
#ERROR : Can't open dsspfile "1oddA.bssp"
#ERROR : Can't open dsspfile "1gxpA.bssp"
#ERROR : Can't open dsspfile "1p2fA1.bssp"
#ERROR : Can't open dsspfile "1qo0D.bssp"
#ERROR : Can't open dsspfile "1b00A.bssp"
#ERROR : Can't open dsspfile "2nx2A1.bssp"
#ERROR : Can't open dsspfile "2fezA1.bssp"
#ERROR : Can't open dsspfile "1a04A2.bssp"
#ERROR : Can't open dsspfile "1tu1A.bssp"
#ERROR : Can't open dsspfile "1f51E.bssp"
#ERROR : Can't open dsspfile "1s8nA.bssp"
#ERROR : Can't open dsspfile "1kgsA1.bssp"
#ERROR : Can't open dsspfile "1tmyA.bssp"
#ERROR : Can't open dsspfile "1ny5A1.bssp"
#ERROR : Can't open dsspfile "1dcfA.bssp"
#ERROR : Can't open dsspfile "1i3cA.bssp"
#ERROR : Can't open dsspfile "1m5tA.bssp"
#ERROR : Can't open dsspfile "1bmtA2.bssp"
#ERROR : Can't open dsspfile "1a2oA1.bssp"
#ERROR : Can't open dsspfile "1d5wA.bssp"
#ERROR : Can't open dsspfile "2b4aA1.bssp"
#ERROR : Can't open dsspfile "1xn8A.bssp"
#ERROR : Can't open dsspfile "1dz3A.bssp"
#ERROR : Can't open dsspfile "1l5yA.bssp"
#ERROR : Can't open dsspfile "1oxbB.bssp"
#ERROR : Can't open dsspfile "1ogcA.bssp"
#ERROR : Can't open dsspfile "1w25A2.bssp"
#ERROR : Can't open dsspfile "1p6qA.bssp"
#ERROR : Can't open dsspfile "1cb7A.bssp"
#ERROR : Can't open dsspfile "1skoA.bssp"
#ERROR : Can't open dsspfile "1xrsB1.bssp"
#ERROR : Can't open dsspfile "2pggA1.bssp"
#ERROR : Can't open dsspfile "1r8jA2.bssp"
#ERROR : Can't open dsspfile "1do8A1.bssp"
#ERROR : Can't open dsspfile "1cvrA1.bssp"
#ERROR : Can't open dsspfile "1gzhB2.bssp"
#ERROR : Can't open dsspfile "1dv7A.bssp"
#ERROR : Can't open dsspfile "1iovA1.bssp"
#ERROR : Can't open dsspfile "1e1cA2.bssp"
#ERROR : Can't open dsspfile "1o57A1.bssp"

## Summary of PDB Search
:235
    5e-29  33%  1p2fA2 [c.23.1.1] RESPONSE REGULATOR A:1 -- 120
    2e-28  29%  1a0oA  [c.23.1.1] CHEY
    1e-26  32%  1ys6A1 [a.4.6.1] TRANSCRIPTIONAL REGULATORY PROTEIN PRRA A:128 --
    3e-26  41%  1oddA  [a.4.6.1] TRANSCRIPTIONAL REGULATORY PROTEIN OMPR
    5e-26  34%  1gxpA  [a.4.6.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    7e-25  37%  1p2fA1 [a.4.6.1] RESPONSE REGULATOR A:121 -- 217
    5e-24  11%  1qo0D  [c.23.1.3] AMIR
    6e-24  33%  1b00A  [c.23.1.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    7e-24   7%  2nx2A1 [c.129.1.2] HYPOTHETICAL PROTEIN YPSA A:1 -- 177
    2e-23  26%  2fezA1 [a.4.6.1] PROBABLE REGULATORY PROTEIN EMBR A:10 -- 104
    3e-23  27%  1a04A2 [c.23.1.1] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN NARL
    7e-23  13%  1tu1A  [d.107.1.3] HYPOTHETICAL PROTEIN PA0094
    1e-22  29%  1f51E  [c.23.1.1] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    2e-22  24%  1s8nA  [c.23.1.1] PUTATIVE ANTITERMINATOR
    2e-22  33%  1kgsA1 [a.4.6.1] DNA BINDING RESPONSE REGULATOR D A:124 -- 225
    3e-22  27%  1tmyA  [c.23.1.1] CHEY PROTEIN
    3e-22  22%  1ny5A1 [c.23.1.1] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY) A:1 --
    1e-21  21%  1dcfA  [c.23.1.2] ETR1 PROTEIN
    1e-21  18%  1i3cA  [c.23.1.1] RESPONSE REGULATOR RCP1
    4e-21  25%  1m5tA  [c.23.1.1] CELL DIVISION RESPONSE REGULATOR DIVK
    5e-21  14%  1bmtA2 [c.23.6.1] METHIONINE SYNTHASE A:741 -- 896
    1e-20  21%  1a2oA1 [c.23.1.1] CHEB METHYLESTERASE A:1 -- 140
    3e-20  22%  1d5wA  [c.23.1.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    2e-19  22%  2b4aA1 [c.23.1.1] BH3024 A:2 -- 119
    2e-19   8%  1xn8A  [a.229.1.1] HYPOTHETICAL PROTEIN YQBG
    3e-19  25%  1dz3A  [c.23.1.1] STAGE 0 SPORULATION PROTEIN A
    6e-19  24%  1l5yA  [c.23.1.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
    7e-19  26%  1oxbB  [c.23.1.1] SLN1
    2e-18  15%  1ogcA  [c.133.1.1] HIGH AFFINITY RIBOSE TRANSPORT PROTEIN RBSD
    4e-18  22%  1w25A2 [c.23.1.1] STALKED-CELL DIFFERENTIATION CONTROLLING PROTEIN
    8e-18  28%  1p6qA  [c.23.1.1] CHEY2
    3e-17  10%  1cb7A  [c.23.6.1] PROTEIN (GLUTAMATE MUTASE)
    1e-15  10%  1skoA  [d.110.7.1] MITOGEN-ACTIVATED PROTEIN KINASE KINASE 1
    7e-15   9%  1xrsB1 [c.23.6.1] D-LYSINE 5,6-AMINOMUTASE BETA SUBUNIT B:102 --
    7e-14  12%  2pggA1 [e.8.1.4] RNA-DIRECTED RNA POLYMERASE A:31 -- 804
    7e-14  16%  1r8jA2 [c.23.1.5] KAIA A:1 -- 135
    1e-12   8%  1do8A1 [c.2.1.7] MALIC ENZYME A:280 -- 573
    8e-12  11%  1cvrA1 [b.1.18.12] GINGIPAIN R A:351 -- 432
    8e-11  20%  1gzhB2 [c.15.1.4] TUMOR SUPPRESSOR P53-BINDING PROTEIN 1 B:1867 --
    1e-10  11%  1dv7A  [c.1.2.3] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    4e-09  15%  1iovA1 [c.30.1.2] D-ALA\:D-ALA LIGASE A:1 -- 96
    4e-08  10%  1e1cA2 [c.23.6.1] METHYLMALONYL-COA MUTASE ALPHA CHAIN A:561 -- 728
    7e-06  17%  1o57A1 [a.4.5.40] PUR OPERON REPRESSOR A:2 -- 74
:235

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKILLIDDENSIARLVGSMAGDAGYAFAYAEDGAEGLVVAEREAPDLVIMDVMMPRMDGFTTCRLMRER
1p2fA2          --KIAVVDDDKNILKKVSEKLQQLGRVKTFL-TGEDFL--NDEEAFHVVVLDVXLPDYSGYEICRXIKET
1a0oA           --KFLVVDDFSTMRRIVRNLLKELGFNNVEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAD
1ys6A1          ----------------------------------------------------------------------
1oddA           ----------------------------------------------------------------------
1gxpA           ----------------------------------------------------------------------
1p2fA1          ----------------------------------------------------------------------
1qo0D           --QVLVLNPPGEVSDALVLQLIRIGCSVRQCWPPPEAF-----DVPVDVVFTSIFQNRHHDEIAALLAAG
1b00A           -RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRE
2nx2A1          LKVLAITGYKPFELGIFKQDDKALYYI---KKAIKNRLIAFLDEGLEWILISGQLGELWAAEAAYDLQEE
2fezA1          ----------------------------------------------------------------------
1a04A2          --TILLIDDHPMLRTGVKQLISMAPDITGEASNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLREK
1tu1A           --DLEIPDDQSINIFKLPASGPAREASFVISRDASQGD--APFADYVARQLENAEKQLPGFKLHKRWDIN
1f51E           -EKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVI
1s8nA           -RRVLIAEDEALIRMDLAEMLREEGYEVGEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIA-S
1kgsA1          ----------------------------------------------------------------------
1tmyA           -KRVLIVDDAAFMRMMLKDIITKAGYEVGEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKI
1ny5A1          --NVLVIEDDKVFRGLLEEYLSMKGIKVESAERGKEAYKLLSEKHFNVVLLDLLLPDVNGLEILKWIKER
1dcfA           --KVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHE-HKVVFMDVCMPGVENYQIALRIHER
1i3cA           -KVILLVEDSKADSRLVQEVLKTSTIDHELIILLQQQGEYENSPRPNLILLDLNLPKKDGREVLAEIKPD
1m5tA           -KKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLDDD
1bmtA2          -GKMVIATVKGIGKNIVGVVLQCNNYDLGVMVPAEKILRTAKEVNADLIGLSGLIPSLDEMVNVAKEMER
1a2oA1          --RVLSVDDSALMRQIMTEIINSHSDMEATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFLEKLMRL
1d5wA           -YTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTXLRMPDMSGVELLRNLGDL
2b4aA1          --RVTLVEDEPSHATLIQYHLNQLGAEVTVHPSGSAFFQRSQLSTCDLLIVSDQLVDLSIFSLLDIVKEQ
1xn8A           --------------------------------KSYSVFESVKTRPDELLKQDILEATADIILKVGHDFSD
1dz3A           --KVCIADDNRELVSLLDEYISSQPDMEGTAYNGQDCLQMLEEKRPDILLLDIIMPHLDGLAVLERIRAG
1l5yA           ---VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSADFAGIVISDIRMPGMDGLALFRKILAL
1oxbB           --KILVVEDNHVNQEVIKRMLNLEGIENELACDGQEAFDKSKGENYNMIFMDVQMPKVDGLLSTKMIRRD
1ogcA           ------------------------------NSHLAKILADLGHT-DKIVIADAGLPVPDGVLKIDLSLKP
1w25A2          --RVLIVDDNERQAQRVAAELGVEHRPVIESDPEKAKI--SAGGPVDLVIVNAAAKNFDGLRFTAALRER
1p6qA           --KVLIVDDQVTSRLLLGDALQQLGFKQITAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLGLLQAVRAN
1cb7A           VLGVIGSDCHAVGNKILDHAFTNAGFNIGVLSPQELFIKAAIETKADAILVSSLYGEIDCKGLRQKCDEA
1skoA           ---------------------------------------------------------ADDLKFLYKKLPS
1xrsB1          -------MNMKGYAGHYGLEEMIDAYNLGSQVANEDFIKKAVELEADVLLVSQTVTQKNVHIQNMTHLIE
2pggA1          --PALVVDSSCLIMNL---QIKTYGQGSGNAATFINNHLLSTLVLDQWNLMRQPRPDSEEFKSIEDKLGI
1r8jA2          ---ICIWVESTAILQDCQRALSADRYQLQVCESGEMLLAQTHRDQIDCLILVAANPSFRAV--VQQLCFE
1do8A1          -------------------------------------------------GQGNNVYIFPGVALAVILCNT
1cvrA1          -QTFEVACDYNGAIATLSDDGD--MVGTAIVKDGKAIIK-LNESIADETNLTLTVVGYNKVTVIKDVKV-
1gzhB2          --KVLLVSDQQQNFLELWSEIMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCP--ASVLKCAEALQ-
1dv7A           ------------------------------LMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMRKRFGCR
1iovA1          TDKIAVLLGGTSAEREVSLNSGAAGIDAYPVDPKEVDVTQLKSMGFQKVFIALHGRGGEDGTLQGMLELM
1e1cA2          ------------VIATAYADLGFDVDVGPLFQTPEETARQAVEADVHVVGVSSLAGGHLTLVPALRKELD
1o57A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GITCPVIFLSAKGDIVDKGVGFQAGGDDYMVKPFDPRELLMHIEAHLRRASMAAAPVAPRGDILHAGRFV
1p2fA2          RPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLER---------------------
1a0oA           GAMLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM------------------
1ys6A1          ----------------------------------------------------STATSSS--ETITVGPLE
1oddA           --------------------------------------------------------------VIAFGKFK
1gxpA           -------------------------------------------------------------EVIEMQGLS
1p2fA1          --------------------------------------------------------------LYDFGDLK
1qo0D           TPRTTLVALVEYESPAVLSQIIELECHGVITQPLDAHRVLPVLVSARRISEEMAKLKQKT-EQLQDRIAG
1b00A           SMTIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRR---------------------
2nx2A1          YPDLKVAVITPFYEQEKNWKEPNKEQYEAVLAQADYEASLTHRPYESPLQFKQKNQFFIDKDGLLLLYDP
2fezA1          -------------------------------------------------------------------RLD
1a04A2          SLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQAAAGEMVLSEALTPV----------
1tu1A           IHGHAAVLLREGRDLMLRQVFIERRPAVLITTLTTTPADLPHHEPAWKQA--------------------
1f51E           DENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLP----------------------
1s8nA           KRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVAT------LS
1kgsA1          -------------------------------------------------------------TKLVCGDLI
1tmyA           DPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNK-------------------------
1ny5A1          SPETEVIVITGHGTIKTAVEAMKMGAYDFLTKPCMLEEIELTINKAI-----------------------
1dcfA           HQRPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDNIRDVLSDLLEPRVL------------------
1i3cA           LKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKXVQGIESFWLETVTLPAAPG---------
1m5tA           LAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHFLETIKRLLER---------------------
1bmtA2          QGFLIGGATTSKAHTAVKIEQNYSGPTVYVQNASRTVGVVAALLSDTQRDDFVARTRKEYETV-------
1a2oA1          RPMPVVMVSSLTGGSEVTLRALELGAIDFVTKPQLGIREGMLAYSEMKVRTAARARIAAH----------
1d5wA           KINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEH---------------------
2b4aA1          TKQPSVLILTTGRLI-----ESSEHNLSYLQKPFAISELRAAIDYHKP----------------------
1xn8A           AEYIPLPETVRLALLKLSQFYALINGDESIIKGYTTEKIGDYSYTLGDGSSL-QKPDVYAL---IKDYVK
1dz3A           FEQPNVIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIRQVYGK---------------------
1l5yA           DPDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSARRAEKKRRL------------------
1oxbB           GYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTE-------------------------
1ogcA           GLPA--FQDTAAVLAEEMAVEKVIAAAEIKASNQENAKFLENLFSEQEIE--------------------
1w25A2          TRQLPVLAMVDPDDRGRMVKALEIGVNDILSRPIDPQELSARVKTQIQRK--------------------
1p6qA           TKKAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKMKAAIEAVFGAL--------------------
1cb7A           GLEGILLYVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNI---------------------
1skoA           VEGLHAIVVSDRDGVPVIKVANDNAPEHAL-RPGFLSTFALATDQGSKLGLSKNKSI-------------
1xrsB1          LLERDRFVLLCGGPRINNEIAKELGYDAGFGPGRFADDVATFAVKTLND---------------------
2pggA1          NFKIERSIDDIRGKLRQL---VLLAQPGYLSGGVEPEQSSPT----------------------------
1r8jA2          GVVVPAIVVGDRDPAKEQ----------------------------------------------------
1do8A1          RHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKXAFR---YPEPEDKA
1cvrA1          ----------------------------------------------------------------------
1gzhB2          ---LPVVSQEIQCLIVGERIGFKQ-HPKYKHDYV------------------------------------
1dv7A           IIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTE-----------
1iovA1          GL--PYTGSGVMA---------------------------------------------------------
1e1cA2          GRPDILITVGGVIPEQDFDELRKDGAVEIYTPGTVIPESAISLVKKLRAS--------------------
1o57A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LDRGQFRVTKDGERLSLTPKEFKIFFALASSPGLVLSKEQLVEAAWGKEFVGETSSITVFIKKLREKVED
1p2fA2          ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1ys6A1          VDIPGRRARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEA
1oddA           LNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEE
1gxpA           LDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALE-
1p2fA1          IDATGFTVFLKGKRIHLPKKEFEILLFLAENAGKVVTREKLLETFWEDPV--SPRVVDTVIKRIRKAIED
1qo0D           QARINQAKVLLMQRHGWDEREHQHLSREAMKRREPILKQELL----------------------------
1b00A           ----------------------------------------------------------------------
2nx2A1          EKEGTAEKRREQDGYPIYFITMDDLRVTVE----------------------------------------
2fezA1          FGLGPLQMTIDGTPVPSTPKQRAVLAMLVINRNRPVGVDALITALWEEWPSGARASIHSYVSNLRKLLGG
1a04A2          ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1s8nA           ERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVL--------------------
1kgsA1          LDTATKKAYRGSKEIDLTKKEYQILEYLVXNKNRVVTKEELQEHLWVFS-----DVLRSHIKNLRKKV-D
1tmyA           ----------------------------------------------------------------------
1ny5A1          ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1xn8A           PADPDLE----GIEAKVRMRS-------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1ogcA           ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1skoA           ---ICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFE-----------------------
1xrsB1          ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
1r8jA2          ----------------------------------------------------------------------
1do8A1          KYVKERTWRSEYDSLLPDVYE-------------------------------------------------
1cvrA1          ----------------------------------------------------------------------
1gzhB2          ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
1iovA1          ----------------------------------------------------------------------
1e1cA2          ----------------------------------------------------------------------
1o57A1          -------------KFRRSGRLVDLTNYLLTHPHELIPLTFFSE-----RYESAKSSISEDLTIIKQTFEQ


                         .         .         .         +         .         .         .:280
query           DPSDPRVIQTVWGIGYRFEPExxxx
1p2fA2          -------------------------
1a0oA           -------------------------
1ys6A1          GGG-PRLLHTVRGVGFVLRMQ----
1oddA           DPAHPRYIQTVWGLGYVFVPD----
1gxpA           PGGHDRMVQTVRGTGYRFS------
1p2fA1          DPNRPRYIKTIWGVGYXFT------
1qo0D           -------------------------
1b00A           -------------------------
2nx2A1          -------------------------
2fezA1          AGIDPRVVLAAAPPGYRL-------
1a04A2          -------------------------
1tu1A           -------------------------
1f51E           -------------------------
1s8nA           -------------------------
1kgsA1          KGFKKKIIHTVRGIGYVARDE----
1tmyA           -------------------------
1ny5A1          -------------------------
1dcfA           -------------------------
1i3cA           -------------------------
1m5tA           -------------------------
1bmtA2          -------------------------
1a2oA1          -------------------------
1d5wA           -------------------------
2b4aA1          -------------------------
1xn8A           -------------------------
1dz3A           -------------------------
1l5yA           -------------------------
1oxbB           -------------------------
1ogcA           -------------------------
1w25A2          -------------------------
1p6qA           -------------------------
1cb7A           -------------------------
1skoA           -------------------------
1xrsB1          -------------------------
2pggA1          -------------------------
1r8jA2          -------------------------
1do8A1          -------------------------
1cvrA1          -------------------------
1gzhB2          -------------------------
1dv7A           -------------------------
1iovA1          -------------------------
1e1cA2          -------------------------
1o57A1          QGIGT--LLTVPGAGVKYIPK----