[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV55075.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1aipC2.bssp"
#ERROR : Can't open dsspfile "1xb2B3.bssp"
#ERROR : Can't open dsspfile "1xb2B1.bssp"
#ERROR : Can't open dsspfile "1aipC1.bssp"
#ERROR : Can't open dsspfile "1xb2B2.bssp"
#ERROR : Can't open dsspfile "1efuB4.bssp"
#ERROR : Can't open dsspfile "2di0A1.bssp"
#ERROR : Can't open dsspfile "1vegA.bssp"
#ERROR : Can't open dsspfile "2bwbA1.bssp"
#ERROR : Can't open dsspfile "1wj7A1.bssp"
#ERROR : Can't open dsspfile "2cp8A1.bssp"
#ERROR : Can't open dsspfile "1v92A.bssp"
#ERROR : Can't open dsspfile "1wglA.bssp"
#ERROR : Can't open dsspfile "2dahA1.bssp"
#ERROR : Can't open dsspfile "1wgnA.bssp"
#ERROR : Can't open dsspfile "2g3qA1.bssp"
#ERROR : Can't open dsspfile "1aipC2.bssp"
#ERROR : Can't open dsspfile "1xb2B2.bssp"

## Summary of PDB Search
:286
    8e-31  33%  1aipC2 [d.43.1.1] ELONGATION FACTOR TS C:54 -- 196
    9e-20  19%  1xb2B3 [d.43.1.1] ELONGATION FACTOR TS, MITOCHONDRIAL B:223 -- 331
    2e-18  31%  1xb2B1 [a.5.2.2] ELONGATION FACTOR TS, MITOCHONDRIAL B:56 -- 111
    5e-18  50%  1aipC1 [a.5.2.2] ELONGATION FACTOR TS C:2 -- 53
    5e-17  32%  1xb2B2 [d.43.1.1] ELONGATION FACTOR TS, MITOCHONDRIAL B:112 -- 222
    2e-16  31%  1efuB4 [d.43.1.1] ELONGATION FACTOR TS B:55 -- 139
    1e-11  12%  2di0A1 [a.5.2.4] ACTIVATING SIGNAL COINTEGRATOR 1 COMPLEX SUBUNIT
    6e-11  20%  1vegA  [a.5.2.1] NEDD8 ULTIMATE BUSTER-1
    5e-10  21%  2bwbA1 [a.5.2.1] UBIQUITIN-LIKE PROTEIN DSK2 A:328 -- 371
    6e-10  28%  1wj7A1 [a.5.2.1] HYPOTHETICAL PROTEIN (RSGI RUH-015) A:8 -- 98
    1e-09  27%  2cp8A1 [a.5.2.1] NEXT TO BRCA1 GENE 1 PROTEIN A:8 -- 48
    2e-09  21%  1v92A  [a.5.2.3] NSFL1 COFACTOR P47
    2e-09  21%  1wglA  [a.5.2.4] TOLL-INTERACTING PROTEIN
    1e-08  30%  2dahA1 [a.5.2.1] UBIQUILIN-3 A:8 -- 48
    2e-08  20%  1wgnA  [a.5.2.1] UBIQUITIN ASSOCIATED PROTEIN
    3e-07  26%  2g3qA1 [a.5.2.1] PROTEIN YBL047C A:1339 -- 1381
    1e-06  35%  1aipC2 [d.43.1.1] ELONGATION FACTOR TS C:54 -- 196(query 57->107)
    7e-05  15%  1xb2B2 [d.43.1.1] ELONGATION FACTOR TS, MITOCHONDRIAL B:112 -- 222(query 227->285)
:286

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAAVTASMVKELREMTGAGMMECKKALVEADGNIDQAVDVLRTRGLAAVAKKAGRATNEGTVMAIVSDDA
1aipC2          ----------------------------------------------------------------------
1xb2B3          ----------------------------------------------------------------------
1xb2B1          -SASSKELLMKLRRKTGYSFINCKKALETCGGDLKQAESWLHKQAQKEGWSKAAR---------------
1aipC1          -----MELIKKLREATGAGMMDVKRALEDAGWDEEKAVQLLRERGAMKAAKKADR---------------
1xb2B2          -----------------------------------------------------GRKTKEGLIGLLQ--EG
1efuB4          --------------------------------------------------------AADGVIKTKIDGN-
2di0A1          -GVELDSLISQVKDLLPLGEGFILACLEYYHYDPEQVINNILEERLAPTLSQLDRNLDRE----------
1vegA           ---PSQESINQLVYM-GFDTVVAEAALRVFGGNVQLAAQTLAHHGGSLPPDLQFSGPSSG----------
2bwbA1          --ERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSL-----------------------------
1wj7A1          -------KVKQLIDITGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEM-----------------
2cp8A1          -----AALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELL----------------------------
1v92A           MAEERQDALREFVAVTGAEEDRARFFLESAGWDLQIALASFY----------------------------
1wglA           ------EDLKAIQDMFNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEPSGPSSG----------------
2dahA1          -----QVQLEQLRSMGFLNREANLQALIATGGDVDAAVEKLR----------------------------
1wgnA           LSPSERQCVETVVNM-GYSYECVLRAMKKKGENIEQILDYLFAHSGP-----------------------
2g3qA1          ---PKSLAVEELSGM-GFTEEEAHNALEKCNWDLEAATNFLL----------------------------
1aipC2          --------------------------------------------------------AREGIIGHYIHHNQ
1xb2B2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TSGAVVELNCETDFVGMNDKFKAYAEKIAQAALASKPXXXXXXXXXXXXGETVEAVVTDAIHTLGENIQL
1aipC2          ----------------------------------------------------------------------
1xb2B3          ----------------------------------------------------------------------
1xb2B1          ----------------------------------------------------------------------
1aipC1          ----------------------------------------------------------------------
1xb2B2          DTTVLVEVNCETDFVSRNLKFQQLVQQVALGTLLHCQSELSELPAGPEREGSLKDQLALAIGKLGENMIL
1efuB4          -YGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKI------TDVEVLKAQFEEERVALVAKIGENINI
2di0A1          ----------------------------------------------------------------------
1vegA           ----------------------------------------------------------------------
2bwbA1          ----------------------------------------------------------------------
1wj7A1          ----------------------------------------------------------------------
2cp8A1          ----------------------------------------------------------------------
1v92A           ----------------------------------------------------------------------
1wglA           ----------------------------------------------------------------------
2dahA1          ----------------------------------------------------------------------
1wgnA           ----------------------------------------------------------------------
2g3qA1          ----------------------------------------------------------------------
1aipC2          RVGVLVELNCETDFVARNELFQNLAKDLAMHIAMMNP---------------------------------
1xb2B2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ARFAVVEGGAVSSYIHGGGKIGVLVQFDVEGIDPASDGFKQFGRDXXXXXXXXXXXXXTRESVDPAIVEH
1aipC2          -----AREGIIGHYIHHNQRVGVLVELNCETDFVARELFQNLAKDLAMHIAMMNPRYVSAEEIPAEELEK
1xb2B3          -------GFYVGSYVHGAMHSPSLHNL-------------VLGKYGALVICE-------TSELKANLADL
1xb2B1          ----------------------------------------------------------------------
1aipC1          ----------------------------------------------------------------------
1xb2B2          KRAAWVKVPA------------------------------------------------------------
1efuB4          RRVAALEG--------------------------------------------------------------
2di0A1          ----------------------------------------------------------------------
1vegA           ----------------------------------------------------------------------
2bwbA1          ----------------------------------------------------------------------
1wj7A1          ----------------------------------------------------------------------
2cp8A1          ----------------------------------------------------------------------
1v92A           ----------------------------------------------------------------------
1wglA           ----------------------------------------------------------------------
2dahA1          ----------------------------------------------------------------------
1wgnA           ----------------------------------------------------------------------
2g3qA1          ----------------------------------------------------------------------
1aipC2          ----------------------------------------------------------------------
1xb2B2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EKAIYMAQAAESGKPEAIQEKMATGRLEKFFKESTLTEQPFVKNPDQSVSEYAAEVAKNLGGEIKIVDFK
1aipC2          ERQIYIQAALNEGKPQQIAEKIAEGRLKKYLEEVVLLEQPFVKDDKVKVKELIQQAIAKIGENIVVRRFC
1xb2B3          GRRLGQHVVGMAPLSVGSLDDEPGGE-----AETKMLSQPYLLDPSITLGQYVQP------HGVSVVDFV
1xb2B1          ----------------------------------------------------------------------
1aipC1          ----------------------------------------------------------------------
1xb2B2          ----------------------------------------------------------------------
1efuB4          ----------------------------------------------------------------------
2di0A1          ----------------------------------------------------------------------
1vegA           ----------------------------------------------------------------------
2bwbA1          ----------------------------------------------------------------------
1wj7A1          ----------------------------------------------------------------------
2cp8A1          ----------------------------------------------------------------------
1v92A           ----------------------------------------------------------------------
1wglA           ----------------------------------------------------------------------
2dahA1          ----------------------------------------------------------------------
1wgnA           ----------------------------------------------------------------------
2g3qA1          ----------------------------------------------------------------------
1aipC2          ----------------------------------------------------------------------
1xb2B2          ----------------QNLKDQLSTYSKGFLNSSELSELPAGPEREGSLKDQLALAIGKLGENMILKRAA


                         .         *         .         .         .         .         +:350
query           RFVLGE
1aipC2          RFELG-
1xb2B3          RFECGE
1xb2B1          ------
1aipC1          ------
1xb2B2          ------
1efuB4          ------
2di0A1          ------
1vegA           ------
2bwbA1          ------
1wj7A1          ------
2cp8A1          ------
1v92A           ------
1wglA           ------
2dahA1          ------
1wgnA           ------
2g3qA1          ------
1aipC2          ------
1xb2B2          WVKVP-