[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV55248.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1nni1.bssp"
#ERROR : Can't open dsspfile "1rttA.bssp"
#ERROR : Can't open dsspfile "2fzvA1.bssp"
#ERROR : Can't open dsspfile "1t0iA.bssp"
#ERROR : Can't open dsspfile "1t5bA.bssp"
#ERROR : Can't open dsspfile "1ydgA.bssp"
#ERROR : Can't open dsspfile "1rliA.bssp"
#ERROR : Can't open dsspfile "1zwkA1.bssp"
#ERROR : Can't open dsspfile "1d4aA.bssp"
#ERROR : Can't open dsspfile "1sqsA.bssp"

## Summary of PDB Search
:187
    9e-28  27%  1nni1  [c.23.5.4] HYPOTHETICAL PROTEIN YHDA
    9e-26  39%  1rttA  [c.23.5.4] CONSERVED HYPOTHETICAL PROTEIN
    8e-25  23%  2fzvA1 [c.23.5.4] PUTATIVE ARSENICAL RESISTANCE PROTEIN A:1 -- 233
    2e-23  21%  1t0iA  [c.23.5.4] YLR011WP
    3e-18  19%  1t5bA  [c.23.5.3] ACYL CARRIER PROTEIN PHOSPHODIESTERASE
    4e-14  17%  1ydgA  [c.23.5.8] TRP REPRESSOR BINDING PROTEIN WRBA
    2e-13  17%  1rliA  [c.23.5.6] TRP REPRESSOR BINDING PROTEIN
    1e-11  24%  1zwkA1 [c.23.5.8] TRP REPRESSOR BINDING PROTEIN WRBA A:4 -- 196
    1e-10  18%  1d4aA  [c.23.5.3] QUINONE REDUCTASE
    8e-05  19%  1sqsA  [c.23.5.5] CONSERVED HYPOTHETICAL PROTEIN
:187

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMRVREAVREAD
1nni1           ---LVINGTPRKHGRTRIAASYIAALYHTDLID-----LSEFVLPVFNGEAEQSELLKVQELKQRVTKAD
1rttA           IKVLGISGSLRSGSYNSAALQEAIGLVPPGM-SIE--LADISGIPLYNEDVYALGPPAVERFREQIRAAD
2fzvA1          VRILLLYGSLRARSFSRLAVEEAARLLQFFGAET--RIFDPSDLPLPDQVQSDD-HPAVKELRALSEWSE
1t0iA           MKVGIIMGSVRAKRVCPEIAAYVKRTIENSEELIDQKLLQQIALPLQIKSVDEYADSKTRSWSRIVNALD
1t5bA           -KVLVLKSSILGYSQSGQLTDYFIEQWREKHVADEITVRDLAANPVPLTPRQQDALALSDELIAELKAHD
1ydgA           VKLAIVFYSSTGTGYAMEAGRAAGAEVRLLKETAPQDVIDGQDAWKANIEAMKDVPEAT---PADLEWAE
1rliA           -KIAVINGGTRSGGNTDVLAEKAVQGFDAEHIYLD-----------------------YDSIIERILQCH
1zwkA1          -YILVLYYSR--HGATAEMARQIARGVEQGGFEA-----RVRTVPAV------STEGALYATLEDLKNCA
1d4aA           -RALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVEPIISRKDITGKLKDPANFQYPAIVAEQKKLEAAD
1sqsA           ------------------------------------------------------------VIKKELLESD


                         .         .         *         .         .         .         .:140
query           GLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMSGASHAQDQLVGMLSFLDAH
1nni1           AIVLLSPEYHSGXSGALKNALDFLSS-------EQFKYKPVALLAVAGGGKGGINALNNXRTVXRGVYAN
1rttA           ALLFATPEYNYSMAGVLKNAIDWASRP----PEQPFSGKPAAILGASAGRFGTARAQYHLRQTLVFLDVH
2fzvA1          GQVWCSPERHGQITSVMKAQIDHLPLEMAGIRPT--QGRTLAVMQVS-GGSQSFNAVNTLRLLGRWMRMF
1t0iA           IIVFVTPQYNWGYPAALKNAIDRLYHEW--------HGKPALVVSY--GGHGGSKCNDQLQEVLHGLKMN
1t5bA           VIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYGLVTGKRAVVLSSRGGIHKDTPTDLILKVFLGFIGIT
1ydgA           AIVFSSPTRFGGATSQMRAFIDTLGGLW---SSGKLANKTFSAMTSAQNVNGQETTLQTLYMTAMHWGAV
1rliA           ILIFATPIYWFGMSGTLKLFIDRWSQTLRDDFKQQMSVKQAYVVGGDNPKIKGLPLIQQFEHIFHFMGMS
1zwkA1          GLALGSPTRFGNMASPLKYFLDGTSSLW---LTGSLVGKPAAVFTSTASLHGG-----------------
1d4aA           LVIFQFPLQWFGVPAILKGWFERVFIGAAMYDKGPFRSKKAVLTGGSGSMYSLQGIHGDMNVILWPIQSG
1sqsA           IIIISSPVYLQNVSVDTKNFIE---RIGGWSHLFRLAGKF----VVTLDVAESN-GSDNVSEYLR-----


                         +         .         .         .         .         *         .:210
query           VMNKPRLCIPHIATQADEQGRLKLESSAPYLEAQADAFVRFVERxxx
1nni1           V-------IPKQLVHIDVENATVAENIKESIKELVEELSXFAK----
1rttA           PLNKPEVMISSAQNAFDAQGRLLDDKARELIQQQLQA----------
2fzvA1          TI-PNQSSIAKAFQEFDAAGRMKPSPYYDRIADVMEELVRFTAL---
1t0iA           VIGGVAVKIPVGTIPLPEDIVPQLSVHNEEILQLLASCI--------
1t5bA           DVNFVF--AEGIAYGPEVAAKAQADAKA-------------------
1ydgA           LTPPGYTDEVIFKSGGNPYGASVTANGQPLLENDRASIRHQVRR---
1rliA           FK-GYVLGEGNRPGDILRDHQAL------------------------
1zwkA1          -----------------------------------------------
1d4aA           ILH--------------------------------------------
1sqsA           -----------------------------------------------