[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV55343.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2o38A1.bssp"
#ERROR : Can't open dsspfile "1y9qA1.bssp"
#ERROR : Can't open dsspfile "1y7yA1.bssp"
#ERROR : Can't open dsspfile "2auwA1.bssp"
#ERROR : Can't open dsspfile "1utxA.bssp"
#ERROR : Can't open dsspfile "1d1lA.bssp"
#ERROR : Can't open dsspfile "1x57A1.bssp"
#ERROR : Can't open dsspfile "1ic8A2.bssp"
#ERROR : Can't open dsspfile "1perL.bssp"
#ERROR : Can't open dsspfile "1s4kA.bssp"
#ERROR : Can't open dsspfile "2icpA1.bssp"
#ERROR : Can't open dsspfile "1b0nA2.bssp"
#ERROR : Can't open dsspfile "2ao9A1.bssp"
#ERROR : Can't open dsspfile "2aw6A1.bssp"
#ERROR : Can't open dsspfile "1lliA.bssp"
#ERROR : Can't open dsspfile "1xwrA1.bssp"
#ERROR : Can't open dsspfile "2ofyA1.bssp"

## Summary of PDB Search
:71
    7e-10  20%  2o38A1 [a.35.1.13] HYPOTHETICAL PROTEIN A:28 -- 116
    4e-09  29%  1y9qA1 [a.35.1.8] TRANSCRIPTIONAL REGULATOR, HTH_3 FAMILY A:4 --
    1e-08  27%  1y7yA1 [a.35.1.3] C.AHDI A:5 -- 73
    1e-08   7%  2auwA1 [a.35.1.10] HYPOTHETICAL PROTEIN NE0471 A:88 -- 154
    1e-08  21%  1utxA  [a.35.1.3] CYLR2
    1e-08   9%  1d1lA  [a.35.1.2] LAMBDA CRO REPRESSOR
    1e-08  20%  1x57A1 [a.35.1.12] ENDOTHELIAL DIFFERENTIATION-RELATED FACTOR 1
    2e-08  17%  1ic8A2 [a.35.1.1] HEPATOCYTE NUCLEAR FACTOR 1-ALPHA A:87 -- 180
    2e-08  28%  1perL  [a.35.1.2] PROTEIN (434 REPRESSOR)
    2e-08  10%  1s4kA  [a.35.1.6] PUTATIVE CYTOPLASMIC PROTEIN YDIL
    2e-08  13%  2icpA1 [a.35.1.3] ANTITOXIN HIGA A:8 -- 94
    2e-08  29%  1b0nA2 [a.35.1.3] PROTEIN (SINR PROTEIN) A:1 -- 68
    9e-08  14%  2ao9A1 [a.4.1.17] PHAGE PROTEIN A:13 -- 132
    2e-07  13%  2aw6A1 [a.35.1.11] PRGX A:1 -- 69
    6e-07  20%  1lliA  [a.35.1.2] PROTEIN (LAMBDA REPRESSOR)
    6e-07  13%  1xwrA1 [a.35.1.9] REGULATORY PROTEIN CII A:2 -- 80
    7e-07  22%  2ofyA1 [a.35.1.3] PUTATIVE XRE-FAMILY TRANSCRIPTIONAL REGULATOR
:71

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKSDGRRIILGKTIKMLREEQHLSQRRFALMVGTNQTHLWQIECGQVSVGIDLLCRIADGLDIKVKDLID
2o38A1          ------KLRLAYALNAVIDRARLSQAAAAARLGINQPKVSALRNYKLEFSVERLXTLLNALDQDVEIVIR
1y9qA1          ------KSQIANQLKNLRKSRGLSLDATAQLTGVSKAXLGQIERGESSPTIATLWKIASGLEASFSAFFA
1y7yA1          -----DLVKFGQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPREL--
2auwA1          --------VSHEXFGDWXHRNNLSLTTAAEALGISRRXVSYYRTAHKIIPRTIWLACLGWEATRPETKT-
1utxA           --------MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQ
1d1lA           ---------MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAE--------
1x57A1          ---DRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKD-
1ic8A2          -----DPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVA-
1perL           ---------ISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGK-TKRPRFLPELASALGVSVDWLLN
1s4kA           ---------NALELQALRRIFDXTIEECTIYITQNSATWQRWEAGDIPISPEIIARLKEXKARRQRRINA
2icpA1          ---------PGDIIQESLDELNVSLREFARAXEIAPSTASRLLTGKAALTPEXAIKLSVVIGSSPQXWLN
1b0nA2          --------MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTPSIQFLEKVSAVLDVSVHTLLD
2ao9A1          LTAKQIQAAYLLVENELMEEEKRTQDEMANELGINRTTLWEWRTKNQDIAFKSEVADSFLAEKREQVYSK
2aw6A1          ---------IGSVLKQIRQELNYHQIDLY-SGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILN
1lliA           ---------LKAIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEFSP
1xwrA1          VRANKRNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKRDW-IPKFSMLLAVLEWGV--------
2ofyA1          ---------LGELLR--SARGDXSXVTVAFDAGISVETLRKIETGRIAPAFFTIAAVARVLDLSLDDVA-


                         .         .         *         .         .         .         .:140
query           F
2o38A1          -
1y9qA1          N
1y7yA1          -
2auwA1          -
1utxA           W
1d1lA           -
1x57A1          -
1ic8A2          -
1perL           -
1s4kA           -
2icpA1          L
1b0nA2          E
2ao9A1          L
2aw6A1          R
1lliA           -
1xwrA1          -
2ofyA1          -