[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV55454.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "2hydA2.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1jqjA2.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1pf4A2.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1oy5A.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1oftA.bssp"
#ERROR : Can't open dsspfile "1heiB1.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1xzpA1.bssp"
#ERROR : Can't open dsspfile "1l8qA2.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "1bifA1.bssp"
#ERROR : Can't open dsspfile "1rz3A.bssp"
#ERROR : Can't open dsspfile "1qhbA.bssp"
#ERROR : Can't open dsspfile "4tmkA.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1f48A2.bssp"
#ERROR : Can't open dsspfile "1tpzA.bssp"
#ERROR : Can't open dsspfile "1oa8A.bssp"
#ERROR : Can't open dsspfile "1j90A.bssp"
#ERROR : Can't open dsspfile "1n0wA.bssp"
#ERROR : Can't open dsspfile "1ny5B2.bssp"
#ERROR : Can't open dsspfile "1a1vA1.bssp"
#ERROR : Can't open dsspfile "1sfjA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "2hydA2.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1jqjA2.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1pf4A2.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1oy5A.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1oftA.bssp"
#ERROR : Can't open dsspfile "1heiB1.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1xzpA1.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "1bifA1.bssp"
#ERROR : Can't open dsspfile "4tmkA.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"
#ERROR : Can't open dsspfile "1f48A2.bssp"

## Summary of PDB Search
:1228
    5e-45  29%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    4e-43  23%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-42  20%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    8e-42  18%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    6e-38  49%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    8e-37  27%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    2e-35  12%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE A:1
    2e-34  25%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    2e-33  14%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    1e-32  11%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    1e-32  12%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    3e-31  17%  2hydA2 [f.37.1.1] ABC TRANSPORTER HOMOLOG A:1 -- 323
    3e-30  10%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC A:260
    2e-28  12%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    2e-28  10%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    1e-27   7%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    2e-27  12%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    2e-27  12%  1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244
    2e-26  12%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    4e-26  12%  1rkbA  [c.37.1.1] PROTEIN AD-004
    7e-26  14%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    2e-25   9%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    2e-24  12%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    2e-24   7%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    2e-24  10%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    3e-24  10%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    3e-24  18%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    3e-24  11%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    7e-24   9%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    3e-23  13%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    6e-23  12%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 -- 417
    1e-22  19%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    1e-22  11%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    1e-22  16%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    2e-22  16%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    2e-22  11%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    5e-22   9%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    8e-22   8%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    2e-21  10%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    2e-21  16%  1g6oA  [c.37.1.11] CAG-ALPHA
    3e-21   9%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    6e-21  11%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    8e-21   8%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    8e-21  13%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2 --
    1e-20   6%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    2e-20  22%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-20   9%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    6e-20  16%  1jb1A  [c.91.1.2] HPRK PROTEIN
    8e-20  19%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    9e-20  16%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    3e-19  10%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    4e-19  11%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    5e-19   8%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    5e-19   9%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    5e-19  12%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    7e-19  15%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    1e-18  11%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    2e-18  14%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    2e-18   9%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    4e-18  14%  1jbkA  [c.37.1.20] CLPB PROTEIN
    4e-18  12%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    6e-18  12%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    1e-17  13%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    2e-17  14%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    2e-17   9%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    1e-16  12%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    3e-16  27%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    3e-16   8%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL) A:141
    3e-16  12%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    4e-16  28%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    5e-16  16%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    5e-16   8%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    6e-16  12%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    7e-16  10%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    1e-15  11%  1t3wA  [a.236.1.1] DNA PRIMASE
    1e-15  19%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    1e-15  16%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    3e-15  15%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    3e-15  17%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    4e-15  10%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    4e-15  12%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    6e-15   7%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    8e-15  17%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    1e-14  10%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    3e-14  10%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    3e-14  21%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    6e-14  12%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    7e-14   8%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    8e-14  10%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
    1e-13  12%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    1e-13  11%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    1e-13  21%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    2e-13  16%  1pf4A2 [f.37.1.1] TRANSPORT ATP-BINDING PROTEIN MSBA A:10 -- 320
    2e-13  11%  1mi8A  [b.86.1.2] DNAB INTEIN
    2e-13  12%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    3e-13  12%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    3e-13  12%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    4e-13  23%  1oy5A  [c.116.1.4] TRNA (GUANINE-N(1)-)-METHYLTRANSFERASE
    4e-13   9%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    4e-13   8%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    8e-13  22%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    3e-12   9%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    4e-12  17%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    4e-12  12%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    6e-12   8%  1sbxA  [a.6.1.4] SKI ONCOGENE
    9e-12  14%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    2e-11   7%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    4e-11   8%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    5e-11  12%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    6e-11  14%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    2e-10  14%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    2e-10  15%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 -- 221
    5e-10  14%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    7e-10  14%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    7e-10  17%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    7e-10  10%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 -- 136
    9e-10   8%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    1e-09  13%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    2e-08  14%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    2e-08  15%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    3e-08  13%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    4e-08   7%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    1e-07  10%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    2e-07  11%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    4e-07  14%  1g31A  [b.35.1.1] GP31
    2e-06  13%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    3e-06  11%  1oftA  [c.37.1.22] HYPOTHETICAL PROTEIN PA3008
    5e-06  22%  1heiB1 [c.37.1.14] HCV HELICASE B:188 -- 325
    8e-06  22%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    1e-05  16%  1xzpA1 [a.24.25.1] PROBABLE TRNA MODIFICATION GTPASE TRME A:118 --
    2e-05  19%  1l8qA2 [c.37.1.20] CHROMOSOMAL REPLICATION INITIATOR PROTEIN DNAA
    2e-05  14%  1dekA  [c.37.1.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    4e-05  15%  1bifA1 [c.37.1.7] 6-PHOSPHOFRUCTO-2-KINASE/ FRUCTOSE-2,6- A:37 -- 249
    1e-04  21%  1rz3A  [c.37.1.6] HYPOTHETICAL PROTEIN RBSTP0775
    1e-04   7%  1qhbA  [a.111.1.2] HALOPEROXIDASE
    1e-04  19%  4tmkA  [c.37.1.1] PROTEIN (THYMIDYLATE KINASE)
    1e-04  23%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE
    2e-04  13%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    2e-04  31%  1accA  [f.11.1.1] ANTHRAX PROTECTIVE ANTIGEN
    2e-04  13%  1dwmA  [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    2e-04  15%  1f48A2 [c.37.1.10] ARSENITE-TRANSLOCATING ATPASE A:309 -- 586
    2e-04  23%  1tpzA  [c.37.1.8] INTERFERON-INDUCIBLE GTPASE
    3e-04  19%  1oa8A  [b.145.1.1] ATAXIN-1
    4e-04  32%  1j90A  [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE
    4e-04  14%  1n0wA  [c.37.1.11] DNA REPAIR PROTEIN RAD51 HOMOLOG 1
    4e-04  26%  1ny5B2 [c.37.1.20] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY) B:138 --
    6e-04  16%  1a1vA1 [c.37.1.14] PROTEIN (NS3 PROTEIN) A:190 -- 325
    9e-04  16%  1sfjA  [c.1.10.1] 3-DEHYDROQUINATE DEHYDRATASE
    1e-36  21%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE(query 352->576)
    1e-37  19%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 331->585)
    8e-33  18%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER(query 350->563)
    5e-32  17%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN(query 368->569)
    2e-30  41%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564(query 344->573)
    5e-28  23%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD(query 354->576)
    1e-28  12%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE A:1(query 367->593)
    1e-30  23%  1ji0A  [c.37.1.12] ABC TRANSPORTER(query 349->575)
    4e-18  13%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706(query 397->597)
    1e-20  11%  1ex6A  [c.37.1.1] GUANYLATE KINASE(query 381->561)
    8e-25  10%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223(query 379->605)
    2e-11  14%  2hydA2 [f.37.1.1] ABC TRANSPORTER HOMOLOG A:1 -- 323(query 46->278)
    1e-21  10%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC A:260(query 367->588)
    1e-15   8%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE(query 367->559)
    5e-20  12%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278(query 379->594)
    3e-24   6%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN(query 368->576)
    4e-20   9%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB(query 346->549)
    1e-09   9%  1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244(query 445->548)
    2e-15  11%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)(query 352->531)
    4e-18  11%  1rkbA  [c.37.1.1] PROTEIN AD-004(query 376->546)
    9e-19  13%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE(query 379->587)
    1e-17   7%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379(query 322->585)
    2e-18   9%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2(query 379->576)
    6e-19   7%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489(query 305->633)
    5e-19   9%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE(query 378->558)
    1e-18  10%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT(query 354->717)
    6e-17  11%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN(query 337->563)
    3e-18  10%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173(query 397->579)
    6e-17   8%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK(query 379->560)
    2e-11  11%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165(query 380->533)
    9e-17  11%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 -- 417(query 352->574)
    1e-17  17%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE(query 379->568)
    2e-13  14%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3(query 342->587)
    1e-11  13%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181(query 378->561)
    2e-21  14%  1ffhA2 [c.37.1.10] FFH A:89 -- 295(query 371->574)
    2e-15   8%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN(query 369->484)
    3e-07   8%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198(query 406->546)
    4e-13   8%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336(query 376->552)
    3e-13  10%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --(query 490->595)
    5e-13  15%  1g6oA  [c.37.1.11] CAG-ALPHA(query 354->552)
    6e-21   7%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397(query 905->1065)
    1e-16   6%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373(query 382->576)
    5e-10   6%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253(query 429->573)
    1e-13  11%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2 --(query 351->543)
    8e-17   9%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251(query 367->589)
    2e-16  19%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN(query 350->581)
    3e-12  10%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT(query 366->483)
    4e-12  13%  1jb1A  [c.91.1.2] HPRK PROTEIN(query 367->529)
    6e-04  13%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865(query 444->518)
    2e-10  14%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150(query 379->452)
    2e-17  10%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)(query 347->452)
    5e-11  14%  1s9hA  [c.37.1.20] REP 40 PROTEIN(query 354->452)
    8e-11  10%  1n25A  [c.37.1.20] LARGE T ANTIGEN(query 373->568)
    3e-14  10%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622(query 357->547)
    6e-09  11%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE(query 367->547)
    2e-11  15%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065(query 352->426)
    1e-09  10%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123(query 423->544)
    2e-10   6%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE(query 367->420)
    2e-09   5%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE(query 509->588)
    1e-13   9%  1jbkA  [c.37.1.20] CLPB PROTEIN(query 342->523)
    8e-09   8%  1e6cA  [c.37.1.2] SHIKIMATE KINASE(query 381->535)
    1e-13  15%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411(query 374->517)
    2e-11   9%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188(query 370->526)
    1e-16  13%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA(query 972->1225)
    2e-11  10%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE(query 379->577)
    3e-05  12%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321(query 442->544)
    6e-10  30%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -(query 507->567)
    1e-13   8%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL) A:141(query 342->452)
    1e-07  13%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173(query 430->563)
    4e-11  23%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID(query 352->588)
    2e-10  11%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607(query 490->575)
    9e-13   8%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395(query 431->614)
    1e-13   6%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I(query 205->492)
    1e-09   9%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE(query 483->635)
    2e-12   9%  1t3wA  [a.236.1.1] DNA PRIMASE(query 392->535)
    6e-12  17%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE(query 367->567)
    2e-10   9%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE(query 490->585)
    5e-10  12%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --(query 377->558)
    9e-13   9%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366(query 344->452)
    2e-07  11%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA(query 394->537)
    3e-13   7%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225(query 972->1057)
    1e-07   9%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445(query 471->585)
    1e-09  15%  1vhhA  [d.65.1.2] SONIC HEDGEHOG(query 473->627)
    2e-05  11%  1viaA  [c.37.1.2] SHIKIMATE KINASE(query 381->529)
    4e-08   9%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200(query 437->622)
    9e-11  19%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)(query 379->568)
    2e-10   9%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306(query 370->535)
    3e-08  12%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132(query 507->576)
    5e-06   6%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283(query 471->612)
    5e-10   7%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180(query 349->407)
    8e-06  26%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1(query 490->558)
    4e-06   8%  1pf4A2 [f.37.1.1] TRANSPORT ATP-BINDING PROTEIN MSBA A:10 -- 320(query 46->275)
    1e-10  10%  1mi8A  [b.86.1.2] DNAB INTEIN(query 342->451)
    7e-07  12%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS(query 379->547)
    5e-08  26%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206(query 379->425)
    1e-09  10%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135(query 509->570)
    1e-05  17%  1oy5A  [c.116.1.4] TRNA (GUANINE-N(1)-)-METHYLTRANSFERASE(query 471->524)
    2e-11  17%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)(query 322->426)
    8e-04  17%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)(query 507->535)
    2e-12  18%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800(query 344->420)
    8e-05  17%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87(query 478->552)
    2e-06  11%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348(query 490->569)
    3e-10  19%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480(query 1140->1225)
    4e-11  15%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180(query 321->450)
    5e-07   5%  1sbxA  [a.6.1.4] SKI ONCOGENE(query 513->577)
    4e-11  15%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1(query 972->1071)
    8e-06   9%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2(query 405->572)
    8e-05   9%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381(query 507->551)
    2e-08  14%  1e2hA  [c.37.1.1] THYMIDINE KINASE(query 376->446)
    4e-10  11%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494(query 972->1025)
    5e-10  15%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 -- 221(query 371->425)
    4e-06  35%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --(query 373->403)
    5e-06  14%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2(query 351->527)
    8e-06   5%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 -- 136(query 509->566)
    5e-08  18%  1esmA  [c.37.1.6] PANTOTHENATE KINASE(query 325->392)
    8e-06   6%  1esmA  [c.37.1.6] PANTOTHENATE KINASE(query 542->573)
    3e-04  15%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171(query 513->559)
    3e-08  22%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244(query 381->439)
    3e-08   9%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --(query 508->585)
    6e-08   5%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511(query 376->451)
    4e-07  17%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228(query 369->451)
    3e-04  11%  1g31A  [b.35.1.1] GP31(query 510->582)
    1e-05  16%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT(query 1124->1201)
    4e-04  13%  1oftA  [c.37.1.22] HYPOTHETICAL PROTEIN PA3008(query 996->1133)
    2e-04  16%  1heiB1 [c.37.1.14] HCV HELICASE B:188 -- 325(query 376->424)
    2e-04  29%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143(query 1006->1058)
    2e-04  10%  1xzpA1 [a.24.25.1] PROBABLE TRNA MODIFICATION GTPASE TRME A:118 --(query 982->1067)
    3e-04  16%  1dekA  [c.37.1.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE(query 383->452)
    6e-05  19%  1bifA1 [c.37.1.7] 6-PHOSPHOFRUCTO-2-KINASE/ FRUCTOSE-2,6- A:37 -- 249(query 380->449)
    9e-04  30%  4tmkA  [c.37.1.1] PROTEIN (THYMIDYLATE KINASE)(query 379->401)
    3e-04  23%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE(query 997->1022)
    5e-04  18%  1f48A2 [c.37.1.10] ARSENITE-TRANSLOCATING ATPASE A:309 -- 586(query 366->427)
:1228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVAIYFMIRDAVGVYPNLAAVDVSAM
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1n0wA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ---------------------------------------------MLIPLLIKYAIVINNHALTTDEKVH
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ---------------------------------------------TYMISLLKPLLDEG--FGNAESNFL
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TGYAGLAVAGIVVDVGCYLAALLCSHAAAFDAQYRTKLDIAAHLGRIPLGHIARLGTGRISKVMDESVGG
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1n0wA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          HLTIAIGIALFIFVIVRPPIEFIRQYLAQWTSNYDIRKKLYNHLQALSARFYANNQVGQVISRVINDVEQ
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          RILPFMILGLMFVRGLSGFASSYCLSWVSGNVVMQMRRRLFNHFMHMPVRFFDQESTGGLLSRITYDSEQ
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IEQFIGHSIPDXXXXXXXXXXXXXXXFVFDWRFGXXXXXXXXXXXXXQFSGYADKRVMASMGRYQEVKEQ
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1n0wA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          TKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYVFF--GRLRKLTRERSQALAE
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------DDAFGA
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          VAGATSRALVS---------------IVREGAS---------------------IIGLLTLMFWNSWQLS
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MGNASVEYVRGMRVVKAFGQTARSFKRLSDAIKDYTGLSLDVTLFFRNSMPGFTAVLNNAYLFVLPVGIL
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1n0wA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          VQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGPIIVIGVG--
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           VVRQLQKAIRAGEIFQVVP-SRRFSLPCPSPLAAYYVLK-------KSNPSPYMFFMQDNDFTLFSPESS
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          LVLI-VVAPVVAFAISFVSKRFRKISRNMQTAMGHRQQTMKLVSAQSIADPVIQMIASLALFAVL-----
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LAPGAQDWPTXXXXXXXXXXXXHSISSVFTKILYVSEDGMLAQANIDRIDSVLGIEELSCPEAPKAPKDA
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ------------------------------VETARNTIDYFVDFVDNVCMDEMVRESQRNGIAPQSDSLI
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ---------------------------------------------------------------------A
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          --------------------------------------------ITHVGSSYTGLATWTSCEDLNPDHAI
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ------------------------------------------------------------LXDKCLPKVR
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1tpzA           ----------------------NDLPSSFTGYFFNTGRKIISQEILNLIELRM--RKGNIQLT-------
1oa8A           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1n0wA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           --------------------------------------------------TGIIMENVT-AFWEEGFGEL
1sgwA           ---------------------------------------------------------------------S
1e69A           ----------------------------------------------------------------------
1pf4A1          ---------------------------------------------------------------EAERVNG
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           --------------------------------------------------------------------DI
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           -----------------------------------------------------------------TRIVS
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          -----------------------------------------GEELLGRVVDALGNAIDGKGARRRVGLKA
1udwA           ----------------------------------------------------------------------
2iqhA1          ------------------------MCTELKLSDYEGRLIQNSLTIERMVLSAFDTGGVDGKWRRELILYD
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           --------------------------------------------------------GFSDYTPRPGDLKH
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           -------------------------------------------------------------EAAIATREE
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ---------------------------------------------------------------------G
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ------------------------------------------------------------------SVNS
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           -------------------------------------------------------------ALKKYTIDL
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          -------------------------------------------------------------AVVPVIQYN
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           LKYDAASRQIEIYPIAGTRPRGRRADGTLDRDLDSRIELDMRTDHKELSEHLMLVDLARNDLARICDLTK
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ---------------------------------------------------------------PKNPD-K
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
3cddA2          --------------------------------------------------------------------EI
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           -------------------------------------------------------------LISLASTGK
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           -----------------------------------------FKPTADRP-FVLGLPTGGTPMTVEMHKAG
1cd5A           ----------------------------------------------------------------------
1e3mA2          ---------------------------------------------------------------PTFIDKP
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------LTDCGADHLFGVPGDYNLQFL-------DH
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           --------------------------------------------SEDEIARLKGINEDLSLEEVAEIYLP
1esmA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREM
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          KLSGIKFKRINFDNSSEYIENWNLQNRRQRTSVLADASETMLANVTSV-RQEYAIPVGPVFPPGMNWTDL
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ii8.1          -----------------SHSDTVVEFKEGINL-IIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKV
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           THKPINILEAFAAA-PPPLDYVLPNMVAGTVGALVSPGGAGKSMLAQLAAQIAGGPDLLEVGELPTGPVI
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          VTITAAHRKSFFRVWLRATLSYELDEHDHTVSTTQLRGFYNFGKRELLL-APLKGQSEGYGVICDFNLGD
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           -----------------ALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISFVNSTSHFWLE
1gm5A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          -IRTRRAAELLDK--RIVISIDSWPTPLGHFVRDLGTIESAQAETEALLLEHDVEYR-------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           --------------------------PAAFSELSLSGLPGHCLTLLAPILRELSEEQDARWLTLIAPPAS
1heiB1          ----------------------------------------------------------------------
2gujA1          -------------------------------------VKKGSDPYFTLQAVLDDQSSGRVTLYDVNFDSA
1xzpA1          ----GEVVTRLERIKEKLTEELKKADAGILLNRGQEIFERGSDSLITNLRQGHLEDAIKSLKEGMPVDMA
1l8qA2          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1rz3A           --------------------------------GIDGLSRSGKTTLANQLSQTLREQGISVCVFHXDIVER
1qhbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCE----------------
1mkyA1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1tpzA           -----------NSAISDALKEIDLNV------AVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVT--
1oa8A           ----------------------------------------------------------------------
1j90A           --------------------------------LIEGNIGSGKTTYLNHFEKYKN----------------
1n0wA           -------------------------IETGSITEXFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAXYID
1ny5B2          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1b0uA           -LHVIDLHKRYGG--HEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLV
1q3hA           LEKVSFSHLCLVG--NPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCS
1sgwA           KLEIRDLSVGYD---KPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKV
1e69A           -----------------SFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPA
1pf4A1          EVDVKDVTFTYQGKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDY
1l7vC           ---LQDVAEST------RLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGXTS-GKGSIQFAGQPLEAW
1m3eA1          ----------------TDAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGVDNF
1ji0A           VLEVQSLHVYY--GAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNK
1yvuA2          ----------------------------------------------EKLIPVINKIKDVDLVIVFLLYDF
1ex6A           ------------------------------PIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRA
1nijA1          ----------------------------IAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGEVSV
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------MLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFD
1poiA           ----------------TLKDAIAKYVHSGDHIALGGFTTDRYAAVFEILRQGITDLTGLGGAAGGDWDML
1jalA1          ----------------------------GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMPDP
1t06A           -----------------TVMQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAKKI--KLNQELAEE
1e9rA           GGKLKRMTREKAKQ--VTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1jqjA2          ----------------------------------------------------------------------
1qhlA           -GKFRSLTLINW----NGFFARTFDLDELVT-TLSGGNGAGKSTTMAAFVTALIPDLTLLLHGKLKAGVC
1rkbA           -------------------------LMLLPNILLTGTPGVGKTTLGKELASKSGLK--YINVGDLAREEQ
1jjvA           ----------------------------TYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVAREVVAK-
1bmfA3          PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIY
1udwA           ----------------------------PFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVLT
2iqhA1          KEEIRRIWRQANNLTHMMIWHSNLNDATYQRTRALVRTG-MDPRMCSLMQGSTLPRRSGAAGAAVKGVGT
1grqA           ---------------------------TTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMP
1mjgM           ---IKLTKIKLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGK-IEVIGPDIDQI
1urjA           ETTGEALCERLGLDPDVVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMPDFSRVIA
1bgxT2          ----------------------------------------------RGMLPLFEPKGRVLLVDGHHL---
1kgdA           ----------------------------RKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPEE
2axpA1          -----------------------------TLIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGN
1pv4A3          -ILFENLTPLHANSRLRRVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVLLIDER
1q3tA           ----------------------------TIQIAIDGPASSGKSTVAKIIAKDFGLDTGAMYATYMALKNQ
1mukA           ETLMRARRHSYSSFS--KLLEAYLLVKW-----RMCEAREPSVDLRPLCAGI-DPLNSDPFLKMVSVGPM
1zp6A1          ---------------------------GGNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDLWGYIK
1ffhA2          --------------------ARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRP
1l7lA           ------------------KGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQG
1ohcA1          -------------------------------------------------------PQDDVYLDITDRLCF
2yyeA2          -------------------------AQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLALNDK
1o7d.2          ----------------------------------------------------------------------
1g6oA           ---EEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIEDTEEIVF
1qhdA1          ----------------------------------------------------------------------
2gx8A1          -------------------------------AGAGHIGNYSHCTFSSEGTGTFVPQQLEVRIETIIPASL
2gk3A1          ----------------------------------------------------------------------
1c4oA1          TFRYRGPSPKGDQ--PKAIAGLVEALDGERFVTLLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQL
2v3jA1          ----------------QAPPVLTSKDKITKRXIVVLAXASLETHKIYVLLNCDDH-QGLLKKXGRDISEA
1vplA           AVVVKDLRKRIGK--KEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEE
1l1oA           ---------------RSRINAGMLAQFIDKPVCFVGRLEKIHPTGKM--FILSDGEGKNGTIELMEPLDE
1jb1A           ----------------RSXHGVLVDIY-GLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQDEQ
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------GQIQVILGPMFSGKSTELMRRVRRFQIAQYKCVIKYAKDTRA
1ckvA           NAYDAGIMGLKKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNANGKIEV
1s9hA           ---LELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFND
1n25A           ----------------------VYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFV
1tljA           ------LVWEELR--EKALNKIYHDKEIGYLDPDILG------FLLAFYRNRNDVYTQSSCSGRITIVDA
1d6jA           ----------------TRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
1fl9A           -IPDEFSMLRF--GKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEEY
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------EVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGF
1afrA           ----------------------------------------------------------------------
1jbkA           TERAEQGKLDPVIGRDEEIRRTILQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLAL
1e6cA           ------------------------------PIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGM
1lw7A2          -----------------------ARPFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEKL
1atrA1          -------------------KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGD
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------GKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERSTRIG
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          KSSIDGVPYGKAHTLGLKKNIQTNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNANTFQH
1zs3A1          ----------------------------------------------------------------------
1g6hA           -LRTENIVKYFGEF--KALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           VDRYSYVMHLVSRVVGELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRGSYGGAVGYFTA-
1f8xA           ----------------------------------------------------------------------
1t3wA           -----------------------------------------KRTTXRILIGLLNPELATLVPPLENLDEN
1cr0A           ----------------TGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAESVEET
1mm8A           ----------------------------------------------------------------------
1ak2A1          --------------------------PKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVAS
1jqjA3          HLEAGCDLLKQAAASNEKFRGVRLYVSENQLKITANNPEQEEAEEIL-----------DVTYSGAEMEIG
1f46A           -------------------------------------------IIMNVAAHHGSELNGELLLNSIQ----
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ------------------------------NIVFIGFXGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQ
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------APVITIDGPSGAGKGTLCKAMAEALQLDSGAIYRHHVDVSED
1ni3A1          -------------------KVQWGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDPE-E
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
3cddA2          VLKAGGKIYQGWTGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVD-------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           RVSIKDLLDEK-DFEIWAINEQTMKLESAKVSRV-FMTGKKLVYILKTRLGRTIKATANHRFLTIDGWKR
1np6A           ----------------------------IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHEL
2ancF1          ----------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGV
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           QVSFKHVVTFNMDE-YVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSY
1cd5A           ----------------------------------------------------------------------
1e3mA2          GIRITEGRHPVVVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVPAQKVEIG
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          VIDSPDICWVGCANELNASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGAPGTAA
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1l3aA           ------------------------------------------------------VFVGYSIYKGKAALT-
2vgmA3          ----------------------------------------------------------------------
1e2hA           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASE
2vnuD1          ----------------------------------------------------------------------
2je6I3          --------------------GIVIDIMPVKVPRVIGKNKSMYETLTS--KSIFVANNGRIWAFSEEILIE
1yj5A2          ----------------------SLLSPNPEVVVAVGFPGAGKSTFIQEHLVSA-----------------
1odfA           SKTVLDYTIEFLDKYIPEWFETGNKCPL--FIFFSGPQGSGKSFTSIQIYNHL-------------MEKY
2pa7A1          ----------------------------------------------------------------------
1esmA           LSRLLNFYISSRRQAVLEQFLGTNGQRIPYIISIAGSVAVGK----------------------------
1esmA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ------------------------------IVVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVLDTGVKEL
1a4iA2          ----------------------------------------------------------------------
1g8fA3          -------------------------PKQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKIFEHTEL
1b77A2          ------------------VASVITEIKAEDLQQLL-----RVSRGLQIDTIAITNKDGKIVINGYNKVED
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          -------------------------PQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVGSPITY
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1dekA           --------------------------------FLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAA
1bifA1          -----------------------------TLIVMVGLPARGKTYISKKLTRYLNFI-------GVPTREF
4tmkA           ----------------------------SKYIVIEGLEGAGKTTARNVVVE-------------------
1p5zB           ----------------------------------------------------------------------
1f48A2          ---------------IPSLSALDIARNEHGLIMLMGKGGVGKTTMAAAIAVRLADMGFDVHLTTSDPAAH


                         .         .         +         .         .         .         .:490
query           GQDELMGSLSLVFQDSHLFRESVAENIRRGRPGXXXXXXXXXXXXXXXXXFINGLPHGYATVIGSEGVHL
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ITNYSP--SREDNLQRVFTVASIRSML-------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ii8.1          GARDTYIDLIFEKDGTKYRITRRFLKGYSSGE--------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           YLPAEDPPTAIHHRLHALGAHLSAEERQAVA-------------------DGLLIQPLIGSLPNIMAPEW
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          DDHADCPSSLFVCAHFNAQR--------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           PLTDTKVAMDDATTTCWTYFDTYMRNALDGNP--------------------------------------
1gm5A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           LTHEWLRRAGLNRERILLLQAKDNAAAL------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          KIASLDEEVPFTFEDFDV----------------------------------------------------
1xzpA1          SIDLERALNLLDEVTGRSFREDLLDTIFS-----------------------------------------
1l8qA2          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1rz3A           AKRYHTGNEEWFEYDVEWLTHQLFRQLKASHQ--------------------------------------
1qhbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1n0wA           TEGTFR----------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1b0uA           RDKDGQLKVADKNQLRLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAQGKYPVH---L
1q3hA           QFSWIMPGTIKENIIFGVSYDEYRYKSVVKAC--------------QLQQDITKFAEQDNTVLGEGGVTL
1sgwA           KGKIFFLPEEIIVPRKISVEDYLKAVASLYGV------------KVNKNEIMDALESVEVLDLKKKLGEL
1e69A           GSAYVELVFEENGEEITVARELKRTRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLL
1pf4A1          KLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSL
1l7vC           SATKLALHRAYLSQQTPPFATPVWHYLTLHQHDKTRTELLNDV----------AGALALDDKLGRSTNQL
1m3eA1          GLGLLKRXISSYVGENAEFERQYLAGELEVEL-TPQGTLAERIRAGGAGVPAFYTSTGYGTLVQEGGSPI
1ji0A           PAHVIRXGIALVPEGRRIFPETVYENLXXGAY-----NRKDKEGIKRDLEWIFSLFPRLKERLKQLGGTL
1yvuA2          VKRELL-KKXIPSQVILNRLKFVLLNVAEQ----------VLAKTGNIPYKLKEIEGKVDAFVGIDISRI
1ex6A           GEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSG-------NYYGSTVASVKQVSKSGKTCILDIDMQGVK
1nijA1          DDQLIGDRATQIKTLTNGCCCSRSNELEDALLDLLDNLDKGNIQFDR---------LVIECTGMADPGPI
2hydA2          ----------------------------------------------------------------------
1khbA1          AQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLASG--VTITSW
1poiA           IGNGRYINCYTANSGVTNVSRRFRKWFEAGKLDYSQDVIYMMWHAAALGLPFLPVTLMQGSGLTDEWGIS
1jalA1          RLDALAEIVKPERILPTTMEFVDIAGLVAGAS----KGEGLGNKFLANIRETDAIGHVVRCFENIDPLDD
1t06A           LYATGNYDAMYFAGIIADPKAMSESDFDRWIDGAYFYMLSDYVVA------VTLSESNIAQDVADKWIAS
1e9rA           SKFGRD--KDIILNPYDQRKGWSFFNEIRNDY-----DWQRYALSVVPRGKTDEAEEWASYGRLLLRETA
1jqjA2          ------------------------SEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRT
1qhlA           YSM-----LDTINSAGRDRKVDIKPFAIQGLPMSVQPTQLVTETLNERQARVLPKLEAMEGVQFKQFNSI
1rkbA           LYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTLYERLETRGYNEK
1jjvA           -DSPLLSKIVEHFGAQILNRAALRERVFNHDED-----------------KLWLNNLLHPAIRERMKQKL
1bmfA3          VAIGQKSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQ
1udwA           SEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSREETVTVYPADVVLFEGILAF
2iqhA1          MVMELIRMIKRGINRRTRAYERMCNILKGKFQTAAQRTMVDQVRESRNPGNAEFEDLIFLARSALI---L
1grqA           LKMQSAEGGIEFDADGGVSI-----GPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFV
1mjgM           PEGSKLPLGILVDIYGRKMQADFEGVLERRIHDFINYGEGLWH-------TGQRNINWLRVSKDAVAKGF
1urjA           EANHRSIGEKFTYPLNRLLFEAVVGPAAVALRSAAHLAFDENHEGAALPADITFTAFAGGFEQRLASVMA
1bgxT2          -----------AYRTFHALKGLTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFRHEAYGGYK
1kgdA           NGKNYYFVSHDQMMQDISNNEYLEYGSHEDAM------------YGTKLETIRKIHEQGLIAILDVEPQA
2axpA1          EKLFELADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVILRVRGDEE
1pv4A3          PEEVTEXQRLVGEVVASTFDEPASRHVQVAE---------------XVIEKAKRLVEHKKDVIILLDSIT
1q3tA           LGVELLDQHPISFGRSETGDQLVFVGDVDITHPIRENEVTNHVSAIAAIPEVREKLVSLQQEIAQQGGIV
1mukA           LQS-TRKYFAQTLFMAKTVSGNAIDSALLRLRTLGADKKALTAQLLMV-----GLQESEADALAGK---I
1zp6A1          HGRIDPW----LPQSHQQNRXXQIAADVAGRYAKEGYFVILDGVVRPDWLPAFTALARPLHYIVLRTTAA
1ffhA2          AAREQLRLLGEKVGVPVLEVMDGESPESIRRRV---------------------EEKARLEARDLILVDT
1l7lA           LICHDAF-CGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIG------
1ohcA1          AILRPKSASNVHYFDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHF----------T
2yyeA2          ARNLMCTDVTGFGLLGHAWNICKNSNIGARI---FFEKVPYYQLSENLVKKKIYPKGAIENLNFVKNYLK
1o7d.2          ---------------------------------------------------------------------Y
1g6oA           KHHKNYT--QLFFGGNITSADCLKSCLRXRPD----RIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGS
1qhdA1          ----------------------------------------------------------------------
2gx8A1          QRKVIKAMVTAHPYEEVAYDVYPLDNKGETLGLGKIGYLQEEMTLGQFAEHVKQSLDVK-------GARV
2gk3A1          --------LKVLFIGESWHHXIHSKGYDSFTSSKYEEGATWLLECLRKGG-VDIDYXPAHTVQIAFPESI
1c4oA1          AAEFRE------LFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDASINPEIERLRHSTTRSLDVIVVAS
2v3jA1          RPDITHQCLLTLLDSPINKAGKLQVYIQTSRG---ILIEVNPTVRIPRTFKRFSGLXVQLLHKLSIRSEE
1vplA           PHEVRKLISYLPEEAGAYRN-----MQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKDRVSTY
1l1oA           EISGIVEVVGRVTAKATILCTSYVQFKEDSH-------PFDLGLYNEAVKIIHDFPQFYPLGI-------
1jb1A           TIVGAAPPILSHLLEIRGL--GIIDVXN--LFGAGAVREDTTISLIVHLENWTPDQLIFDVPVPKITVPV
1iioA           -----------------------GSHMKMGVKEDIRGQIIGALAGADFPILMAALPNGPDTTCKSGDVEL
1xbtA1          LPACLLRDVAQEALGVAVIGIDEGQFFPDIVE--------------------------------------
1ckvA           DCDEISELLGRQFNVYDFLVDVSSTIGRAYTL--------------------------------------
1s9hA           CVDKMVI---WWEEGKMTAKVESAKAILGGSK--------------------------------------
1n25A           VFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKT---L
1tljA           EMPWDRKNSTIIFKNHITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAKNIETGWDILKIAREAGFKHSGI
1d6jA           FGLNKDLGFSEADRNENIRRIAEVAKLFADS-------------NSIAITSFISPYRKDRDTARQLHEVA
1fl9A           NIAGKM----------------------------------------------------------------
2f9hA1          --TEIGKHAIDDSEKXIILGETATDTLKQHAVIQSFPEKDQVTLA-----EGDHLKIGDTNYTITKVGSF
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           DMGA-LVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAMDAGNMLKPALARGELHCVGATT
1e6cA           TVADVVAAEGWPESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAALRLQASLQAHQRP
1lw7A2          GGDEQAMQYSDYPQXALGHQRYIDYAVRHSH---------------------KIAFIDTDFITTQAFCIQ
1atrA1          AAKNQVAMNPTNTVFDAKRRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYF
1g8yA           ----------------------------------------------------------------------
1tmkA           GLINEYLTDDSFQLSDQAIHLLFSANRWEIVDKIKKDLLEG---------KNIVMDRYVYSGVAYSAAKG
1es6A2          ---------------------SFHPKLR---PILLPNKNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNI
1f2t.1          ----------------------------------------------------------------------
1pgsA2          QLGALGCSANPINNQSPGNWTPDRAGWCPGMA--------------------------------------
1zs3A1          ---------AEIDHHKPTAGAHVLSNLFIENRLTQAGIYAKSPVKCEYLREIAQREVEYFFKIS----DL
1g6hA           AELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKKLSHLYDRKAGEL
1bs2A1          ---------------------------------------------------------------------L
1j1zA2          ----------LLHISYEGGLEDPWAEPPGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAV-----------
1i1qA           -------------HGDLDTCIVIRSALVENGI-ATVQAGAGIVLDSVPQSEADETRNKARAVLRAIATAH
1f8xA           --------------------------------------------------------------IYFGAGWF
1t3wA           KLPGLGLFRELVNTCLSQPGLTTGQLLEHYRG------------TNNAATLEKLSXWDDIADKNIAE--Q
1cr0A           AEDLIGLHNRVRLRQSDSLKREIIENGKFDQ-------------------WFDELFGNDTFHLYDSFAEA
1mm8A           ---------------------------------------------------------------------R
1ak2A1          GSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVI
1jqjA3          FNVSYVLDLNALKCENVRMMLTDSVSSVQIED--------------------------------------
1f46A           -------QAGFIFGDMNIYRHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGD---E
2gtlM1          ----------------------------------------------------------------------
2qgmA1          --------------------------------------------------IVKSIQSQANPLKTI----E
1vhhA           ----------------------------------------------------NVAEKTLGASGRYEGKIT
1viaA           KVSEIFEQKRENFFREQEQKXADFFSSCEKACIATGGGFVNVSNLEKAGFCIYLKRLDKDEISKRPLFYD
1dnpA2          ----------------WFRQDRLHDNLALAA----------------ACRNSSARVLALYIATPRQWATH
1ckeA           ALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIA
1ni3A1          AKVAVPDERFDWLCEAYKPKSRVPAFLTVFIAGLTKGASTGVGLGNAFLSHVRAVDAIYQVVRAFDDAEI
1dhyA1          ----------------------------------------------------------------------
1zbsA1          --------------------------------------------------EIKANVSPLGYILGDEGSGA
3cddA2          ----------------------------------------------------------------------
1w1wA           ---------------------------------------------------------------------L
1pf4A2          ----------------------------------------------------------------------
1mi8A           LDELSLKEHIALRKSDISWDSIVSITETGVE---------------------------------------
1np6A           RKAGAAQTIVASQQRWALMTETPDEEELD--------------------LQFLASRMDTSKLDLILVEGF
2ancF1          DVFLD-----------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           --------------------------------------------------VDERVKKIVDMEISLGDFIL
1cd5A           GKIHLF----------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ---------------------------------------------------------EEHDERTRAKARL
3cddA1          ---------------------------------------------------------------------T
1uouA3          ----------------------------------------------------------------------
1ovmA2          --QQRGELLHHTLGDGEFRFYHMSEPITVA----------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1l3aA           VEPRSPEFSPLDSGAFKLSMLQFAPAAGVRQYDWSRKQVFSLSVTEIGSII--SLGTKDSCEFFHD---P
2vgmA3          ----------------------------------------------------------------------
1e2hA           TIANIYTTQHRLDQGEISAGDAAVVM--------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          AIRKI-----------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           GGEKSIGYASIDDFYLTHEDQLKLNEQFKNNKLLQGRGLPGTHDMKLLQEVLNTIFNQDTVVLPKYDKSQ
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          PYEPSIDVREFVTVEEIMR---------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          LSLQDFIGSGSGLIIPDQWEDDKDSVVGKQN---------------------------------------
1b77A2          SGLTRPKSLTLTDYDGSNNFVINMANMKIQP---------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          STYG------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1dekA           ANTDYPXLTRKEFEGIDYDRETNLNLTKLEVI--------------------------------------
1bifA1          NVGQYRRDMVKTYKSFEFFLPDNEEGLKI-----------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1f48A2          LNNLQVS---------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           SGGEXXXXXXXXXXXXDAPIVVLDEATAFSDPENEHLIQKAFERLMAGKTVIMVAHRLSTVVGADKIVVL
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           FDGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQVIGRMEAIAADTGCSIVFLHHLVDNIRWQSYLSSM
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          -------------------------------REQEELLAPADGTVELALPLALVLHELGALRLVGAELLV
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------NATFYLLDNDTTVDGLSAVEQLVCEIAAERSGKRVLIACEDEKQAYRDEALWAR
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1dwmA           ---------------------------------SGNMAAATVERENRVHAIVLKEGSAMTKDFCDRVWVI
1f48A2          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1n0wA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1b0uA           SGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEGKTMVVVTHEMGFARHSSHVIFL
1q3hA           SGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTILVTSKMEHLRKADKILIL
1sgwA           SQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKGIVIISSREELSY---CDVNENL
1e69A           SGGEKALVGLALLFALPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVITHNKIVMEAADLLHGV
1pf4A1          SGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVIAHRLSTIEQADEILVV
1l7vC           SGGEWQRVRLAAVVLQITPLLLLDEPXNSLDVAQQSALDKILSALCQGLAIVXSSHDLNHTLRAHRAWLL
1m3eA1          KYNKDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKADQAGNVTFRKSARNFNLPXCAAETTVV
1ji0A           SGGEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQGTTILLVEQALGALKVAHYGYVL
1yvuA2          TRDGKTVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKAIGDV-------FSLLEKLGFKKGSKIVVH
1ex6A           SVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAATGAHDKVIVNDDLDKAYKLKDFIFA
1nijA1          IQTFFSHEVLCQRYLLDGVIALVDAVHADEQMNQFTIAQSQVGY--ADRILLTKTDVAGEAEKHERLARI
2hydA2          ----------------------------------------------------------------------
1khbA1          KNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFV
1poiA           KEVRKTLDKVPDDKFKYIDNPFKPKVVAVPVPQVDVAIIHAQQASPDGTVRIGKFQDVDIAEAAKYTIV-
1jalA1          IDTINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPVLENAGMIGLDKEELQAIKSYNFL
1t06A           GDELAGWSCYCWLLGNRKDNAFSESKISDMLEMVKDTIHHSPERTKMNNFLNTVAISYVPLHEAKEVGIV
1e9rA           KKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEAALTSARFVLSDKLP-----------
1jqjA2          VATDGHRLAVCSMPIGQSGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIF--TSKL------------
1qhlA           TDYHGIIARRLRSASDRSKFYRLIEASLYGSSAITRSLRDY-----------------------------
1rkbA           KLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDH--------------
1jjvA           AEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANFEQIQRIMNSQVSQQERLKWADDVINN
1bmfA3          AVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIEYIPTNVISITDGQIFL
1udwA           YSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPR
2iqhA1          RGSVAHKSCLPACVYGSAVASGYDFEREGYSLVGIDPFRL-----LQNSQVYSLIRPNENPAHSQLVWMA
1grqA           GDLD------VLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEEYDVEVDTTHKESIECAWAIA--
1mjgM           RFKNYGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKDRMRGLTDETVDTFFAPNHVCIV
1urjA           GDAALALESIVSMAVFDEPPTDISAWPLFEGQDTAAARANAVGAYLARAAGLVGAMVFSTNSALHLTEVD
1bgxT2          AGRAPTPEDFPRQLALIKELDLLGLARLEVPGYEADDVLASLAKKAEGYEVRILTADKDLYQLSDRIHVL
1kgdA           LKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRLEEAVEL
2axpA1          GKDIDSILELYREVXSNAGLHTYSWDTGQWSSDEAKDIIFLVE---------------------------
1pv4A3          RLARAYNTVVPAVLTGGVDANALHRPKRFFGAARNVEEG---GSLTIIATALIDTGSKXDEVIYEEFKGT
1q3tA           MDGR------------DIGTVVLPQAKIFLVASVDERAERRYKENIAKGIETDLETLKKEIAARDY---K
1mukA           MLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRHLNTPPRMGWLRAIL--RFLGAGMVMT
1zp6A1          EAIERCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINALQ-------SGRFRI
1ffhA2          AGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEGVTGLVLTKLDGDARGALSARHV
1l7lA           ----------------------------------------------------------------------
1ohcA1          GSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYITLLDCFH--------------
2yyeA2          SNLDNWKLILLSDPVTSGGLLFTIN------KEKLEKIDETAKELVNYWIIGETIAENVLEV--------
1o7d.2          NPLGRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQELLFSALVPAVGFSIYSVSQMPRDLVI
1g6oA           SEEAFIRLANXSSSNSAAFESLIEGFKDLID-----------------XIVHINHHKQCDEF--------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          VGKLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMMLNIVDPGHNVEKVMKQKQLQEK
2gk3A1          DELNRYDVIVISDIGSNTFLLQNETFYQLKIKPNALESIKEYVKNGGGLLXIGGYLSFXGIEAKANYKNT
1c4oA1          VSAIYGLGDPREYRARNLVGFVLFPATHYLSPEGLEEILKEIEKELWERVRYF-----------------
2v3jA1          KLLKVIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEKLDDDESICVFVGAXARGKDNFADEYVDEKVGL
1vplA           SKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGILVSSHNMLEVEFLCDRIALI
1l1oA           ----------------------------------------------------------------------
1jb1A           KVGRNLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLIE-------------------------------
1iioA           KASDGQVLTADDFPFKSAEEVADTIVNK------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           QARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYVAEFAQSIQSRIVEWKRLDKEFSLS
1tljA           LATNQKGVLVELRTGIRMVHLLRESNTERVDKDKKTLVNVCNEVLARGKQKMNLLKD-------------
1d6jA           TPGEETGLPFVEVYVDVPVEAPYEAPANKNYELPVQDAVKQIIDYLDTKGYL-PAKK-------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ANSNLQSIAHSTLIFADAPTDEDDVIRNGVYLTPHQLPKI-----TIGTTIDYL----------------
1afrA           ----------------------------------------------------------------------
1afrA           ------------------TARQAKEHGDIKLAQICGTIAADE-----KRHETAYTKIVEKLFEDPDGTVL
1jbkA           LDEYRQYIEKDAALERRFQKVFVAEPSVEDTIA-------------------------------------
1e6cA           TLTGRPIAEEMEAVLREREALYQDVAHYVVDATQAAIVCELMQTM-------------------------
1lw7A2          YEGKAHPFLDSXIKEYPFDVTILLKNN-------------------------------------------
1atrA1          NDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLD----------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           TNGMDLDWCLQPDVGLLKPDLTL-----FLSTQFGDERYETVKFQEKVKQTFMKLLDKEIRKGDESITIV
1es6A2          MGIEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDCHSPASL----------------
1f2t.1          ----------------EISLLILDEPTPYLDEERRRKLITIMERYLKIPQVILVSHDEELKDAADHVIRI
1pgsA2          ----------------------------------------------------------------------
1zs3A1          LLDENEIVPSTTEEFLKYHKFITEDPKAKYWTDEDLLIVDFQAQNMFITRAIKLANKEEKFALAAGVVEL
1g6hA           SGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAGITFLIIEHRLDIVLNIDHLYVM
1bs2A1          RSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLFKLT-HQVSSCY
1j1zA2          NGERLSPAALLQ----RLNEIGGRHGVGRVDIVENRFVGMKSRGVYETGTILYHARRAVESLTDREVLHQ
1i1qA           HA--------------------------------------------------------------------
1f8xA           TDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPLHDKVWATATYNNDLNGIKTNDIMLGV
1t3wA           TFTDSLNHXFDSLLELRQEELIARERTHGLSNEERLELWTLNQEL-------------------------
1cr0A           ETDRLLAKLAYMRSGLGCDVIILDHISI--RKMIDNLMTKLKGFAKSTGVVLVVICHLKDLRASDTIIAL
1mm8A           KAGAMQTVKLAQ----EFPELLAIEDTTSLSYRHQVAEELGKLGSIQDKSRGWWVHSVLLLEATFRTVGL
1ak2A1          EFSIPDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSGIHSAIDASQTPDVVFAILAAF--
1jqjA3          ----------------------------------------------------------------------
1f46A           LQLFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKD-----------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          PSKPFEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVTEXGFTNFAXEEDWGNGLKLNEYIQ
1vhhA           RNSERFKELTPNY---NPDIIFKDEENTGADRLMTQRCKDKLNALAIPGVKLRVTEGWDEDGHHSEESLH
1viaA           EIKAKKLYNERLSKYEQKANFILNIENKNIDELLSEIKK-------------------------------
1dnpA2          NMSPRQAELINAQLNGLQIALAEGIPLLFREVDDFVASVEIVKQVCASVTHLFYNYQYEVNERRDVEVER
1ckeA           DGRD-----------MGTVVFPDAPVKIFLDASSEERAHRRMLQLQVSVNFERLLAEIKLVPAADALVLD
1ni3A1          IHVE-------GDVDPIRDLSIIVDELLIKDAEFVEKHLEGLRKI-------------------------
1dhyA1          ----------------AWRIAVQPGELDDLAYAGLEVDDAAALERMARQAGVAFTRGD-EALMQQRKVMG
1zbsA1          VLGRLFIGSLLKGQXPEG---LCEAFLQEYGLTSADIIESVYRKPFPNRFLAGFSPFIAQHLDIPAVYSL
3cddA2          ----------------------------------------------------------------------
1w1wA           SGGEKTVAALALLFAINSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLFIVISLKNTMFEKSDALV--
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           KHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLLDVALLDINDGLADFVVEWM-------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ------------------LENLATGAFFPVKGFMTLSVAHEMRLPTGEVWTIPILLQFREKPPGNTVALL
1oy5A           SGGEIVALAVIDAVSRVLPGVLSEPYPVYTRPRE------------------------------------
1cd5A           ----------------------------------------------------------------------
1cd5A           ----------------PKAIMVCDEPSTMELKVKTLRYFNELEAE-------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          SWAGRQXVGVGL-----ARLDPADEPVAQIGDELA--IARALSDL--ANQLFALTSSDIEAS--------
3cddA1          IKAAKADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWERQRSIGKSNXAEYTVTGWRIPQTGINTLVPVI
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------RLCLPQILNSVLRDFSLQQINAVCDHIYCSRCTADQLEIVXGILPFSA
1tueA           ----------------------------------------------------------------------
1l3aA           NKGRSDEGRVRKVLKVEPL---PDGSGHFFNLSVQNKLINLDENIYIAEFAVLVSA-------FNFVMPY
2vgmA3          ----------------ISYLLLTDKVLHSDNIAQREEYLKLMDSVESGGKALVLSTLHSLG---------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           FKGEGDRCPTGQKIKLPVDIFILEGWFLGFNPILQGI---------------------------------
2pa7A1          ------------------QEITLDSPAVGLYVGPAVWHEM-HDFSSDCVMMVLASDYYDETDYRQYDNFK
1esmA           ----------------------------------------------------------------------
1esmA           ---------------------------------------------------VDAPEDLLQTWYINRFLKF
1iqrA2          ----------------------LREAYRARGGALWVLEGLPWEKVPEKAKAVYALTSHTPYGRRDGRVR-
1yr6A1          ----------------------------------------------------------------------
1a4iA2          -----------------APEILNGKEI---SAQIRARLKNQVTEQVPGFTPRLAILQVGNRDDSNLYINV
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           -------------------VILVSEPAQAGDEEVTESGLIIGKRVQGEVPELCVVHSVGPDV-PEGFCEV
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           DGGRKVEEGTHQELLAASGTYAKMWRQYTEAVEWGIEAAPRDDTRSSEATAPHATQGVSAEEYDPAEKPG
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           TSAEAEEWGVDDDQRRFFVRFGVSKANYGAPFADRWFR--------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          DVGQRLRRGTPWLRVHRDGPALSGPSRALQEA--------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           PAESFVPHNLAGEGPRG-----------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1dwmA           VNDHGVVTSV------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1n0wA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1b0uA           HQGKIEEEGDPEQVFG------------------------------------------------------
1q3hA           HQGSSYFYGTFSELQSLRPDFSSKL---------------------------------------------
1sgwA           HKY-------------------------------------------------------------------
1e69A           NGVSAIVPV-------------------------------------------------------------
1pf4A1          DEGEIIERGRHAD---------------------------------------------------------
1l7vC           KGGKXLASGRREEVLT------------------------------------------------------
1m3eA1          EVEEIVDIGSFAPEDIHGEKYEKRIERLSVRKE-------------------------------------
1ji0A           ETGQIVLEGKASELL-------------------------------------------------------
1yvuA2          RDGRLYRD----EVAAF--------KKYGELYGYSLE---------------------------------
1ex6A           E---------------------------------------------------------------------
1nijA1          NARAPVYTVTHGDIDLGL-LFNTNGFMLEENV---VSTKPRFHFI-------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          GAAMRSEAKIIMHDPFAMRPFFGYNFGK------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          TLKPTMYIANVNEDGFENNPYLDRVREIAAKEGA------------------------------------
1t06A           EVKRDNKKSSLLNASE------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           DAELAQNLPHLQQKVLLHQFYLQQAEN-------------------------------------------
1bmfA3          ETEL-FYKGIRPAINVGLSVSRVGS---------------------------------------------
1udwA           GADNLVAINLIVQHIQ------------------------------------------------------
2iqhA1          CHSAAFEDLRVSSFIRGTKVVPRGKLSTRGVQIASNENMETMESSTLELRSYWAIRTRSGGNTSSGQISI
1grqA           ----------------------------------------------------------------------
1mjgM           TPERVGLCGAVSWLDAHAGPNQPIPKEGEIDPIKGIWKSVNDYLYTNPMTSCGCFEAIMAILPECNGIMI
1urjA           DAG-------------------------------------------------------------------
1bgxT2          HPEGYLI--TPAWLWEKYG---------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          GNXELHLSRKIAEK--------------------------------------------------------
1q3tA           DSHRETSP--------------------------------------------------------------
1mukA           ATGVAVLEDIHGGGRSLGQRFMTWMRQ-------------------------------------------
1zp6A1          D---------------------------------------------------------------------
1ffhA2          TGKPIYFAGLEPFY--------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          QNERFDPNTGLLPVRQAFYWYNASTGNNLSSQASG-----------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          VDAKKLNVHIHASQLH------------------------------------------------------
2gk3A1          VLAEVLPVIXLDG---------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          SNYPLSASVACSKFCHG------AEDAWN-----------------------------------------
1vplA           HNGTIVETGTVEELKERYKAQ-------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           VYQKMKFN--------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           AFADMMRKKISMPAHLMYDGRDDNLFDH------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           DVTNKGIQEVEALIWQI-----------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          NGSSKVE---------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          YGY-------------------------------------------------------------------
1g6hA           FNGQIIAEGRGEEEIKNVLSDPKVVEIY------------------------------------------
1bs2A1          DVLWVAGQTEELATA-------------------------------------------------------
1j1zA2          RDMLSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGR----------------
1i1qA           ----------------------------------------------------------------------
1f8xA           YIPDEEDVGLGMELGYALSQGKYVLLVIPD------EDYGKPINLMSWGVSDNVIKMSQLKDFNFNKPRF
1t3wA           ----------------------------------------------------------------------
1cr0A           ERNQLVL---------------------------------------------------------------
1mm8A           LHQEWWMRPDDPADADEKESGKWLA---------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          TGKGNPREFLKLLYPTDEIIAXIEW---------------------------------------------
1vhhA           YEGRAVDITTSDRDRSKYGMLARL---------AVEAGFDWVY----YESKAHIHCSVKAENSVAAK---
1viaA           ----------------------------------------------------------------------
1dnpA2          ALRNVVCEGFDDSVILPPGAVMTGNHEMYKVFTPFKNAVAAPKVRSSGSIEPSPSITLNYPR--------
1ckeA           STTLSIEQ--------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          LLCLQDPFGLPLEIYY------------------------------------------------------
1zbsA1          VQNSFDDFLVRNV------LRYNRPDLPLHFIGSAFHYREVLSSVIKKRGLT------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          HGGERVALLH------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          DEIXGLDEE-------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           PSCGLITKTDAERLCNA-----------------------------------------------------
1tueA           ----------------------------------------------------------------------
1l3aA           LLGWHTAVNSFK----------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          KYIAKI----------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1esmA           REGAFTDPDSYFH---------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          KLKAAEEIGIKATHIKLPRTTTESE---------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           GDLTSLPVGQIRNVPHPFVALG------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           KPSSGRAPWLQRTFNLSDEGYVGLKRSAIACTLSDLALMIPFVCTVAAFAALVGTLAGEPFDAAALWSIF
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ---------------------------TIIVGIFGIPMLIPLLIKYAIDGVINNH--ALTTDEKVHHLTI
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          -----------------------------------------VVSTIALVINAAADTYNAESNFLRILPFM
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1n0wA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          QPT-------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           TTRDHAGMTPSGMTFSTLAGMIGGGTQTPGFMIGRTYIVSKKFISADGGIVWMPKSLKDFLHDEFVRSSV
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           DFYEG-----------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           AVGLAGMVVVFVASRNDYKKTYVAAYTESEGTRLRLADHLRKLPMSFFNRRDTTDVADRIMGDVTAQESM
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          AIGIALFIFVIVRPPIEFIRQYLAQWT-SNKIRKKLYNHLQALSARFYANNQVGQVISRVINDVEQTKDF
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ILGLMFVRGLSGFASSYC--LSWVSGNVVMQMRRRLFNHFMHMPVRFFDQESTGGLLSRITYDSEQVAGA
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1n0wA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           EEGLGEDFIDKIADETI-----------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LSSTLPQLIAGIVSTVVICAMLAFFDWRLACCVMVTLPLSAGVIALSRRHQSRLFERQNRVRLDALACVQ
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYVFFGRLRKLTRERSQALAEVQGFLH
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          TSRALVSIVREGASIIGLLTLMFWNSWQLSLVLIVVAPVVAFAI--------SFVSKRFRKISRNMQTAM
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1n0wA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           DYLEGIKDMRACRAVGKDSAAMEQAMLELKRVTMRVELAVDVSVSLASAILRSGVGLTACVGAVLLASGG
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGS
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          GHR--QQTMKLVSAQSIADPVIQ----------MIASLALFAVLFLAS---------------VDSIRAE
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1n0wA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------IGNLPI
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           VDFMVLLMFLLIVSRVYGPILALVSQLPNLLNLSTKTARIKAVMDEPEARGSASADVPGHDLSFQGVRFG
1b0uA           -------------------------------------------------------------LHVIDLHKR
1q3hA           -------------------------------------------------------------EKVSFSHLC
1sgwA           -------------------------------------------------------------LEIRDLSVG
1e69A           -------------------------------------------------------------LYLKGFK--
1pf4A1          ------------------------------------------LMDLETERGKYEAERVNGEVDVKDVTFT
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           -------------------------------------------------------------LEVQSLHVY
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ITVGTLAAFVGYLELLFGPLRRLVASFTTLTQSFASMDRVFQLIDED-----------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           -------------------------------------------------------------GKLKRMTRE
1jqjA2          ----------------------------------------------------------------------
1qhlA           -------------------------------------------------------------GKFRSLTLI
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          --------------------------------------RVVDALGNAIDGKGPIGSKAPGIIPRISVREP
1udwA           ----------------------------------------------------------------------
2iqhA1          ----MIDGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMVLSAFDTGGPGKWRRELILYDKEEIRRIWRA
1grqA           ----------------------------------------------------------------------
1mjgM           -------------------------------------------------------------IKLTKIKLD
1urjA           -------------------HLDPSTQAPNLTRLCERARRHFGFSDYTPRPGDLKHETTGEALCE---RLG
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          -----------------------------------------------------------NKILFENLTPL
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------IIHNPPSLFDVPHK--WYQGAQEAAIATREELAEMD--ETLMRARRHS
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ------------------------------------------------------------------YNLL
1qhdA1          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          --------------------------------------------------------------RYRGPSPK
2v3jA1          ----------------------------------------------------------------------
1vplA           -------------------------------------------------------------VVVKDLRKR
1l1oA           --------------------------------------------------------------------MM
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           -----------------------------------------------------SVNSNAYDAGIMGLKGK
1s9hA           ---------------------NSRSQIKAALDNAGKIMSLTKTAPDQPVEDISSNRIYKI-LELNGYDPQ
1n25A           ----------------------------------------------------------------------
1tljA           --------------------------------------------------------------------WE
1d6jA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1fl9A           -------------------------------------------------------------IPDEFSMLR
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ------------------------------------------------------------TERAEQGKLD
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ---------------------------------------------------------QYNKSSIDGVPYG
1zs3A1          ----------------------------------------------------------------------
1g6hA           -------------------------------------------------------------LRTENIVKY
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           -------------------------------------------LARICTPGSRYVADLTKVDRYSYVMHL
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------ESVGLL
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ------------------------------------------------------------LLKQAFARAA
1f46A           ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          -------------------------------------------------------------LKAGGKIYQ
1w1wA           ----------------------------------------------------------------------
1pf4A2          LTPGTFTVVFSAMFGLMRPLKALTSVTSEFQRGMAACQTL------------------------------
1mi8A           -------------------------------------------------------------VSIKDLLDE
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ---------------------------------------------------------KAGQVSFKHVVTF
1e3mA2          -------------------------------------------------------------IRITEGRHQ
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          --------------------------------------------------GDYNLQFLDHVIDSPDICWV
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           --------------TLXTPYLQFWAALRDSVPXTLSEDEIARLKGNEDLSLEEVAEIYLPLSRLLNFYIS
1xl3C1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1rz3A           ----------------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1n0wA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1sfjA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          RNWNFDFGLLGTTLLNLDANYVETARNTIDYFVDFVDNVCMDEMVRESQRNGIAPQSDSLIKLSGKRINF
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           -------------------------------------------------------------HKPINILEA
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          -------------------------------------------------------------TITAAHRKS
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           -------------------------------------------------------------LRYQQIEFI
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          -------------------------------------------------------------IRTRRAAEL
2je6I3          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           YGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLAHVSIV
1b0uA           YGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVRDKDGQLKVADK
1q3hA           LVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKE
1sgwA           YD-KPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKVKGKIFFLPEEII
1e69A           -----SFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAGSAYVELVFEEN
1pf4A1          YKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDYKLTNLRRHFALV
1l7vC           -AESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGXT-SGKGSIQFAGQPLEAWSATKLALHRAYL
1m3eA1          -----DAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGVDNFGLGLLLQSISSY
1ji0A           YGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDINKPAHVINRXGIALV
1yvuA2          --------------------------------------PVINKIKDVVIVFLEFLLYDFVKRELLKKXIP
1ex6A           -----------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVS
1nijA1          ----------------IAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGEVSVDDQLIGDRATQI
2hydA2          ----------------------------------------------------------------------
1khbA1          LAEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQGHLRAINPEN
1poiA           ------KDAIAKYVHSGDHIALGGFTTDRKPYVFEILRQGITDLTGLGGAAGGDWDMLIGNGAYINCYTA
1jalA1          ----------------GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMPDPRLDALAEIVKPE
1t06A           ---KTVMQELEALGK-ERTKKIYISNGAHEPVFGVATGAMKPIAKKIK--LNQELAEELYATGNYDAMYF
1e9rA           KAKQVTVAGVPMRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILN
1jqjA2          ----------------------------------------------------------------------
1qhlA           NW--NGFFARTFDLD-ELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLLHGKLKAGV-----CYSMLDTI
1rkbA           --------------MLLPNILLTGTPGVGKTTLGKELASKSGLKYINV--GDLAREEQLYDGYDEEYDCP
1jjvA           ----------------TYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVAREVVAK--DSPLLSKIVEH
1bmfA3          MQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGKRSTVAQL
1udwA           ---------------EPFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVLTSEQKAKALKGQF
2iqhA1          GLTHMMIWHSNLNDATYQRTRALVRTG-MDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRG
1grqA           ----------------TRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEF
1mjgM           LPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVS-ESEITDGKIEVIGPDIDQIPEGSKLPLGILV
1urjA           LDPDRVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMPDFSRVIAEPFNANHGEKFT
1bgxT2          ----------------------------------RGMLPLFEPKGRVLLVDGHHL--------------A
1kgdA           ----------------RKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPEENGKNYYFVSHDQ
2axpA1          --------------------ILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLFEHFNKLAV
1pv4A3          HANSRLVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVLLIDERPEEVTEXQRLVK
1q3tA           ----------------TIQIAIDGPASSGKSTVAKIIAKDFGFTTYMALKNQLGVEEVEALALLDQHPIS
1mukA           YSSFSKLLEAYLLVK-----WRMCEAREPSVDCAGI-----DPLNSDPFLKMVSVGPMLQS-TRKYFAQT
1zp6A1          ---------------GGNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDLWGYIKHGRID-PWLPQS
1ffhA2          ----------LPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRLLGEK
1l7lA           ---------VLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHP-DQGLICHDAFCGAL
1ohcA1          -----------------------------------------RDPQDDVYLDITDRLCFAISRPKSASNVH
2yyeA2          ----------QSGAQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLALNDKARNLMCTDVTGF
1o7d.2          ----------------------------------------------------------------------
1g6oA           DNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIEDTEE--IVFKHHKNYTQLF
1qhdA1          ----------------------------------------------------------------------
2gx8A1          --------------------GAGHIGNYSHCTFSSEGTGTFVPQQLEIIPASLQRKV-----IKAMVTAH
2gk3A1          -------------------------------------------------------------------KVL
1c4oA1          GDQPKAIAGLVELRDGERFVTLLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQLAAEFRELFPENA
2v3jA1          ----QAPPVLTSKDKITKRXIVVLAXASLETHKIYVLLNCDDHQGLLKKXGRDISEARPDITHQCLLTLL
1vplA           IGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPHEVRKLISYLP
1l1oA           DLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKM--FILSDGEGKNGTIELMEPLDEEISGIVEVVGRV
1jb1A           --ERRSXHGVLVDI-YGLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQDEQTIVGAAPPILSH
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------GQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKTRALPACLLRDVAQE
1ckvA           DFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNANGKIEVDCDEISELLGRQ
1s9hA           YAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENF-----PFNDCVDKMVI
1n25A           -------KCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVDRLNFELGVAI-DQFLVVFEDV
1tljA           ELREKALNKIYHDKEIGYLDPDILGFLLAFYRN-------RNDVYTQSSCSGR-ITIVDAEMPWDRKNST
1d6jA           ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGD--NIRFGLNKDLGFS
1ii8.1          --------------------------------ILARTERERVKKEIKDLEKAKDFTEELIEKVKKYKALA
1fl9A           FGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEEYNIA----GKMIY
2f9hA1          ------------------------------------------------------------TEIGKHAIDD
1afrA           --PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGFDEQVRELRERAK
1jbkA           PGRDEEIRRTIQQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALDMGALVAGAKYR
1e6cA           -----------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTVADVVAAEGWP
1lw7A2          --------------FFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEKLGGDEQAMQYSDY
1atrA1          --------GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTN
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------GKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERSTRIGGLINEYLTDDSF
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          KAHTLGLKKNTNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNANTFQHQLGALGCSANPI
1zs3A1          ------------------------------------------------------------------KAEI
1g6hA           FGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYHIVRTF
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ------------------------------------------------------------------ANLL
1i1qA           VSRVVLRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRGS---------------YGGAVGYF
1f8xA           ----------------------------------------------------------------------
1t3wA           -----------------------------KRTTXRILIGLLNPELATLVPPLENLDENKLPGLGLFRELV
1cr0A           FSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLA---------MLEESVEET
1mm8A           -----------------------------------------------------RAADWAKS--------V
1ak2A1          ----------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATM
1jqjA3          AASNEKFRGVRLYVSENQLKITANNPEQEEAEEIL-----------DVTYSGAEMEGFNVSYVLDVLNAL
1f46A           -------------------------------------AHHGSELNGELLLNSIQ-----------QAGFI
2gtlM1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           -----------------KNIVFIGFXGSGKSTLA----RALAKDLDLVFLDIEQKFNQKVSEIFEQKREN
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------APVITIDGPSGAGKGTLCKAMAEALQLDSGAILHHHVDVASEDALVPLAHLDVR
1ni3A1          --------------GNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDPEEAK-VAVPDERFDW
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          GGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVDIGGERVITGYVDDWVPSYDESTITI
1w1wA           ---------------ESNFTSIIGPNGSGKSNMMDAISIYRGPQSAYVKAFYQKGNKLDTSYKIDGKTVS
1pf4A2          ----------------------------------------------------------------------
1mi8A           KDFEIAINEQTMKLESAKV-SRVFMTGKKLVYILKTRLGRTIKATANHRFLTIDGWKRLDE-LSLKEHIA
1np6A           ----------------IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHELRKAGAAQTIVAS
2ancF1          ---------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQLATGVDVFLDIDWQGAQQIRQKM
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           NMDEYVLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAHLFMGGVGNDGHIAFNEPASSLAS
1e3mA2          VLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVPAQKVEIGPIDRIFTRVGFX
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          GCANEASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGAPGTAAQ--QRGELLHHT
1sbxA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1l3aA           --------------------------------------------VGYSIYKGKAALTVEPR---SPEFSP
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------LLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRL
2vnuD1          ----------------------------------------------------------------------
2je6I3          --------GIVIDIMPVKVPRVIGKNKSMYETLTS--KSIFVANNGRIWAFSEEILIEAIRKIENESHI-
1bccF           --------------------------------------------------------------------AG
1yj5A2          ----------SLLSPNPEVVVAVGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCVSSCQAALRQGKR
1odfA           ------------------FIFFSGPQGSGKSFSIQIYNHLMEK--------------YGGEKSIGYASID
2pa7A1          ----------------------------------------------------------------------
1esmA           SNLRREQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGL
1xl3C1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ------------------IVVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVKEPYEPSIDVREFV
1a4iA2          ----------------------------------------------------------------------
1g8fA3          --------------KQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKIFEHNNKTEIQDFIGSGSG
1t9hA2          ---------------------------------------ELIHTSGGLVADTPGFSSLETDIEEEELGYT
1b77A2          ------VASVITEIKAEDLQQLL-----RVSRGLQIDTIAITNKDGKIVINGYNKEDSGLTRPKYSLTLT
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ------------VPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVGSPITYSTYGKGGAYDII
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1l8qA2          ---EVVKEALENLGSLYNPIFIYGSVGTGKTHLLQAAGNEAKKRGYRVIYS--SADDFAQAXVEHLKKGT
1dekA           --------------------FLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYP
1bifA1          ------------------LIVMVGLPARGKTYISKKLTRYLN-------FIGVPTREFNVGQYRRDMVKT
1rz3A           ----------------------------------------------------------------------
1qhbA           ---------------------FHPSYGSGHAVVAGACVTILKAFFDANFQIFEVDTDEDKLVKSFPGPLT
4tmkA           ----------------SKYIVIEGLEGAGKTTARNVVVETLEQ-------LGIRDMVFTREPGGTQLAEK
1p5zB           ----------------------------------------------------------------------
1mkyA1          --------------------LIVGRPNVGKSTLFNKLVKDPVQDTVEWYGKTFKL--VDTCGVFDNPQDI
1accA           --------------------AAVNPSTTKPDTLKEIAFGFNEPN-GNLQYQGKDITEFD-----------
1dwmA           ----------------------------------------------------------------------
1f48A2          ------------------LIMLMGKGGVGKTTMAAAIAVRLADMGFDVHLTTSDPAAHLNNLQVSRIDPH
1tpzA           ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1n0wA           ----------------------------------------------------------------------
1ny5B2          ---KEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLS-----------------------------
1a1vA1          ------------VPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLVAATLGFGAYMSKAHGVDPNIR
1sfjA           -----------------------------------------------------------------HVEVV
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          DNSSEYIENWNLQNRRQRTSVLADASETMLANVTSV-RQEYAIPVGPVFPPGMNWTDLITNY--SPSRED
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           FAAPPPLDYVLPNMVAGTVGALVSPGGAGKSMLAQLAAQIAGGPDLLEVGELPTGPVIYLPAEDPPTAIH
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          FFPNRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLA-PLKGQSEGYGVICDFNLGDDDHADCKSSLFV
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           T-FLGALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISFVNSTSHF--WLEPLTDTKVAML
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          LDKRIVISIDSWPTTLGHFVRDLGTIESAQAETEALLLEHDVEYR-------------------------
2je6I3          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           ---------------AAFSELSLSGLPGHCLTLAPILRELSEEQDARWLT------------LIAPPASL
1heiB1          ----------------------------------------------------------------------
2gujA1          -------------------------VKKGSDPYFTLQAVLDDQSSGRVNFDSAKIASLDEE----EVPFT
1xzpA1          -IKEKLTEELKKADAGILLNRGQEIFERGSDSLITNLRQKQLLDAIKSLKEGMPVDMASIDLERALNLLD
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------IKKISIEGNIAAGKSTFVNILKQLCE----------------------------
1f48A2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           FQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIAR
1b0uA           NQFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAQG---KYPVHLSGGQQQRVSIAR
1q3hA           NIIFGVSYDEYRYKSVV--------------KACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLAR
1sgwA           VPRKISVEDYLKAVASLYGVKVNKNEIMDALESVEVLDLKKKLGE------------LSQGTIRRVQLAS
1e69A           GEEITVARELKRTGENTYYLNGSPVRLKDIRLLFFGGEGRLEISIRKPGRRDQKLSLLSGGEKALVGLAL
1pf4A1          SQNVHLFNDTIANNIAYAAEGETREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLSGGQRQRVAIAR
1l7vC           SQQQTPPFATVWHYLTLHQHDKTRTELLN--DVAGAL--------ALDDKLGRSTNQLSGGEWQRVRLAA
1m3eA1          VGENAEFERQYLAGELEVEL-TPQGTLAERIRAGGAGVPAFYTSTGYGTLVQEGGSPIKYNKDGSIAIAS
1ji0A           PEGRRIFPETVYENLXXGAYNRKDKEGIKRDL-----EWIFSLFPRLKERLKQLGGTLSGGEQQXLAIGR
1yvuA2          SQVILNRLKFVLLNVAEQ----------VLAKTGNIPYKLKEIEGKVDAFVGIDISRITRDGKTVNAVAF
1ex6A           VDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVS-------KSGKTCILDIDMQGVKSVKAIPELNARF
1nijA1          KTLTNGCICSRSNEL----EDALLDLLDNLDKGNIQFDR-----LVIECTGMADPGPIIQTFFSHEVLCQ
2hydA2          ----------------------------------------------------------------------
1khbA1          GFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLA--SGVTITSWKNKEWSSEDGEP
1poiA           NSGVTNVSRRFRKWFEAGKEDYSQDVIYMMWHAAALGLPFLPVTLMQGSGLTDEWGISKEVRKTLDKVPD
1jalA1          RILPTTMEFVDIAGLVAGASKGEGLG----NKFLANIRETDAIGHVVRCFENIDPLDDIDTINTELALAD
1t06A           AGIIADPKAMSESDFDRWIDGAYFYMLSDYVVAVTLSESNIAQD------VADKWIASGDELKMSAGWSW
1e9rA           PYDQRTKGWSFFNEIRNDYD-WQRYALSVVPRGKTDEAEEWASYGRLL-----LRETAKKLALIGTPSMR
1jqjA2          ------------SEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVCS
1qhlA           NSAGRDRKVDIKPFAIQGLPMSVQPTQLVTETLNERQARVLDKLEAMEGVQFKQFNSITDYHSLMFDLLR
1rkbA           ILDEDRVVDELDNQMREGGVIVDYHGCDFFPWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQ
1jjvA           FGAQILNRAALRERVFN-----------------HDEDKLWLNNLLHPAIRERMKQKLAEQTAPYTLFVV
1bmfA3          VKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR
1udwA           NFDHPDAFDNELILKTLKEITEGKTVQIPVYDFSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMK
2iqhA1          INRRTRIAYRMCNILKGKFQTAAQRTMVDQVRES---RNPGNAEFEDLIFLARSALILRGSVAHKSCLPA
1grqA           DADGGVS-----IGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGV--
1mjgM           DIYGRKMQADFEGVLERRIHDFINYGEGLWHTGQRNINWLRVS-------KDAVAKGFRFKNYGEILVAK
1urjA           YPLNRLLFEAVVGPAAVALRSR---NVDAVARAAAHLAFDENHGAALPADITFTAFAGGFEQRLASVMAG
1bgxT2          YRTFHALKGLTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPR
1kgdA           MMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQA------------LKVLRTAEFAPF
2axpA1          IIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVLRVRGDEYIEGKDIDILELYR
1pv4A3          GEVVSTFDEPASRHVQV---------------AEXVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPA
1q3tA           FGRSETGDQLVFVGDVDITHPIRENEVTNHVSAIAAIPEVREKLVSLQQEIAQQGGIVMDGR----DIGT
1mukA           LFMAKTVSGNAIDSALLRLRTLGADK----KALTAQLLMVGLQESEADALAGK----IMLQDVNTVQLAR
1zp6A1          HQQNRXIXQIAADVAGRYAKEGYFVILDGVVRPDWLPAFTALARPLHYIVLRTTAAEAIERCLDR--GGD
1ffhA2          VGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGR---------------------LQIDEPLMG
1l7lA           VMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGK-----------------
1ohcA1          YFSIELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHF----------TGSDQRKQANAAF
2yyeA2          GLLGHAWNICKNSNIGARIFFEKVPYYQLSENLV---KKKIYPKGAIENLNFVKNYLKSNLDNWKLILLS
1o7d.2          ---------------------------------------------------------YNPLGRKVDWMVR
1g6oA           FGGNITSADCLKSCLRXR----PDRIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRLSSSN
1qhdA1          ----------------------------------------------------------------------
2gx8A1          PYEEVAYDVYPLDNKGETLGLGKIGYLQEEMTLGQFAEHVKQSLD-------VKGARVVGKLDDKVRKVA
2gk3A1          FIGESWHHXIHSKGYDSSKYEEGATWLLECLRKGG----VDIDYXPAHTVQIAFPESIDELNRYDVIVIS
1c4oA1          VEYFISYYDYYQPEAYV------PGKDLYIEKDASINPEIERLRHSTTRSLDVIVVASVSAIYGLGDPRE
2v3jA1          DSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLXVQLLHKLS----IRSEEKLLKVIKNPITD
1vplA           EEAGAYRNMQGIEYLRF-----VAGFYASSSSEIEEMVERATEIAGLGEKIKDRVSTYSKGMVRKLLIAR
1l1oA           TAKATILCTSYVQF-KEDSHPFDLGLYNEAVKIIH------DFPQFYPLGI-------------------
1jb1A           LLEI--RGLGIIDVXNLFGAGAVREDTT--ISLIVHLENWTPDQLIFDVPVPKITVPVKVGRNLAIIIEV
1iioA           -----------GSHMKMGVKEDIRGQIIGALAGADFPELMAALPNGPDTTCKSGDVELKASDAGQVLTAD
1xbtA1          ALGVAVIGIDEGQFFPDIVEFCEAMANAGK-------------TVIVAALDGTFQRKPFGAILNLVPLAE
1ckvA           FNVYDFLVDVSSTIGRAYTL---GNKFTITSELMGLDRKLE-----------------------------
1s9hA           WWEEGKMTAKVVESAKAILGG-SKVRVDQKCKSSAQIDPT-----PVIVTSNTNMCAVIDGNSTTFEHQQ
1n25A           KGTGGESRDLPSGQGI--NNLDNLRDYLDGSVKVNLEKKHLNPPGIVTMNEYSVPKTLQARFVKQIDFRP
1tljA           IIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAKNIETGWDILKIAREHSGILATNQKGVLVEL
1d6jA           EADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVA-----------TPGEETGLPFVE
1ii8.1          REAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSL
1fl9A           HFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEILVNIDYYDDARNIELIAQTNLGKNIIS
2f9hA1          SEKXIILFGTATDTLKQHAVIQSFPEKDQVTLAEGDHLKI-----GDTNYTITKVGSFANSNLQSIAHST
1afrA           ESWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLGFIYTSFQERAT
1jbkA           GEF-EERLKGVLNDLAKQEGNVILFIDELHTMVGAMDAGNMLKPALARGELHCVGATTLDEYRQYIEKDA
1e6cA           ESEALQAVATPNRVVATGGGMVLLEQNRQFHGTVVYLFAPAEELALRLQASLQAHQRPTLTGRPIAEEME
1lw7A2          PQXALGHQRYIDYAVRHSH---------------------KIAFIDTDFITTQAFCIQYEGKAHPFLDSX
1atrA1          TVFDAKRLIKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAG
1g8yA           ----------------------------------------------------------------------
1tmkA           QLSDQAIHLLFSANRWE------IVDKIKKDLLEGKNIVMDRYVYSGVA--YSAAKGTNGMDLDWCLQPD
1es6A2          -----LRPGSFHPKLR---PILLPNKNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVLK
1f2t.1          -------------------------------RAEENKVRLFVVWEGKERPLTF----LSGGERFRLAMSL
1pgsA2          NNQSPGNWTPDRAGWCPGMAVPTRIDVLNNSLTGSTFSYEYKF---------------------------
1zs3A1          DHHKPTAGGHVLSNLFIENIRLTQAGIYAKSPVKC--EYLREIAQEYFFKISD----LLLDENEIVPSTT
1g6hA           QTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKKLSHLYDRKAGELSGGQMKLVEIGR
1bs2A1          -------------------------------------------------------SRLRSVERNASGITQ
1j1zA2          HISYEGGVEDPWAEPPKG-----------MFRMTQDPEEAPDAPEYVEVEFFEGPVAVNGERLSPAALLQ
1i1qA           TAHGDLDTCVIRSALVENGI-ATVQAGAGIVLDSVPQSEADETRNKARAVLRAIATAHHA----------
1f8xA           --------------------------------------------------IYFGAGWFTDRQNKAYKEAM
1t3wA           NTCLSQPGLTTGQLLEHYRGTN-NAATLEKLSXWDDIADKNIAE-------------QTFTDSLNHXFDS
1cr0A           AEDLI----GLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFH------LYDSFAEAETDRLLAKL
1mm8A           FSSAALGDPLVNVAAQLAKYSGKSITISSEGSKAA----QEGAYRFIRNPNVSAEAIRKAGAMQTVKLAQ
1ak2A1          DAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRR
1jqjA3          KCENVRMMLTDSVSSVQIEDAASQSYVVMPMR--------------------------------------
1f46A           FGDMNIYHRLSPDGSGPALFSLANMVKPGTFDPEMKDFTT---PGVTIFMQVPSYGDELQLFKLMLQSAQ
2gtlM1          ----------------------------------------------------------------------
2qgmA1          -----------------------------SGQSVQ-KNIVKSIQSQANPLKTI----EPSKPFEDLKPLK
1vhhA           -------------------------------------AYKQFIPNVAEKTLGYEGKITRNSERFKELTPN
1viaA           FFREQEQKXADFFSSCEKACIATGGGFVNVSNLEKADFEYLKKRLDKDEISKRPLFYDEIKAKKLYNERL
1dnpA2          -------------HLVWFRQDLR---LHDNLALAAACRNSSARVLALYIATPRQWATHNMSPRQAELINA
1ckeA           FVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADG----------
1ni3A1          LCEAYKPKSRVPAFLTVFDIAGLTKGASTVGLGNAFLSHVRAVDAIYQVVRAFDDAEIIHVEGDVDPIRD
1dhyA1          -----------------------GYLGFAVKDVPAWDHFLTKSVGL-----------MAAGSAGDAALYR
1zbsA1          -----------------------SEGIACSNSCLFDGREIKANVSPLGYILGDEGSGAVLGRLFIGSLLK
1d8jA           ------LSGSSGYKF------GVLAKIVNYMKTRH--QRGDTHPLTLDEI-LDETQHLDIGLKQKQWLMT
3cddA2          SVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQRIQIEQGETPHELLAR
1w1wA           YKDYSIFLENIKAKNFLVFQGDVEQIAAQSPVELSRMFTFDYVSDHLDAIYRELTGNLSGGEKTVAALAL
1pf4A2          ----------------------------------------------------------------------
1mi8A           LPRDISWDSIVSITETGVEEDLTVPGPHNVANDIIVHASI------------------------------
1np6A           QQRWALMTETPDEE--------------------ELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFR
2ancF1          PHARSIFILPPSKIELDRRLRGRGQDSEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAE
1v47A1          ---------------------------------------------------------------PALEIGE
1oy5A           ----------------------NQKLVNELSKKERYEGVDERVKKIVDMEISLGDFILSGGEIVALAVID
1cd5A           RTRIKTLTHDANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISC
1e3mA2          VEXTETANI---LHNATEYSLVLXDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATHYFELTQLPEK
2fggA1          ---------------------------SEHGKTCQIDVLI-----EEHDERTRAKARLSWAGRQXVGVGL
3cddA1          ---------------------ASKTKAGVSLILGDNVKAARGRFSWRQRFSKF----TIKAAKADVTDSE
1uouA3          ----------------------------------------------------------------------
1ovmA2          LGDGEFRHFHMSEPITVAQAVLTENACYEIDRVLT-----------------------------------
1sbxA           -------------------------------------------------------SDRSTERCETVTISC
1tueA           ----------------------------------------------------------------------
1gm5A1          ---------EALPTLLEEFLNEVEKMLKNQVNTRRIHQLLKELDDPLLEN-----KDLEEKLQAFLDYVK
1l3aA           LDSGAFKLSMVMLQFAPAAGVRQYDWSRKQVFSLSVTEIGSIISLG-TKDSCEFFHDPNKGRSDEGRVRK
2vgmA3          -----------------------------------------MVMDEFLLHLNKDDDKAWYGE-KEVVKAA
1e2hA           DQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARYLMG
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           FNKYGLMDDTIYENDDVKEAIRRLPENLYDDRMFRIKRALDLNMRQ--------QILPKEQWTKYEEDVP
1yj5A2          VVIDNTNPDVPSRARYIQCAKDAGVPCRCFNFCATIEQARHNNRFREXTDPSHAPVSDXVXFSYRKQFEP
1odfA           DFYLTHEDQLKLNEQFKNNKLLQGRGLPGTHDMKLLQEVLNTIFNQDTVVLPKYDKSQFKGEGDRCPTGQ
2pa7A1          ---------------------------------------------------------LNGSCRVILDDGN
1esmA           XKKKGFPES------------------------YDXHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGD
1xl3C1          --------EFMGDIVALVDRWAGIHDIEHLANALPTPEIXVRFYQDLXRMFRLFPLGVFSDEEQRQNLLQ
1iqrA2          -----------------WHRGDLRLHDHPALL-----EALARG--PVVGLVVLDPNNLKTTPRRRAWFLE
1yr6A1          TVEEIMREGYGPNGAIVESYDRLMEKFNEYLNKILR----------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          LIIPDQWEDDKDSVVGKQNVYLLDTSSSADIQ--------------------------------------
1t9hA2          FPDIREKSSCKFRGCLHLKE--PKCAVKQAVEDGELKQYRYDHY-----------VEFMTEIKDR-----
1b77A2          DYDGSNNFVINMANMKIQPGKVMLWGAGD--KVAAKFESSQ-----------------------------
1g31A           --------------------------------------------------------------------LP
1em8A           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1heiB1          ICDECHSTDATSILG-------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1l8qA2          INDLLLLDDTQIEFFHIFNTLYLLEKQIILASDRHPQKLDGVSDRLVSRFEGGILVEIELDNKTRFKIIK
1dekA           XLTRKEFE-----GIDYDRETNLNLTKLEVTIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITD
1bifA1          YKSFEFFLPDNEEGLKIRKQCA-------LAALNDVRKFLSE--EGGHVA----VFDATNTTRERRAMIF
1rz3A           ----------------------------------------------------------------------
1qhbA           VAGELNKLA-------------------------------------------------------------
4tmkA           LRSLLLDIKSVGDEVITDKAEV---LMFYAARVQLVETVIKPALANGTWVIGDSTQAYQGGGRIDQHMLA
1p5zB           ----------------------------------------------------------------------
1mkyA1          ISQKXKEVTLNXIREADLVLFVVDGKRGITKEDESLADFLRKS--TVDTILVANKAENLREFEREVKPEL
1accA           ----FNFDQQTSQNIKNQLAELNATNIYTV----------------------------------------
1dwmA           ----------------------------------------------------------------------
1f48A2          EETERYLETKGKELDEAGKRLLEEDLRSPCTEEIAVFQAFSRVEAGKRFVV-------------------
1tpzA           ----------------------------------------------------------------------
1oa8A           ---------------------------------------------------------FAVGEHRAQVSVE
1j90A           ----------------------------------------------------------------------
1n0wA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1a1vA1          TGVRTITTGSPITYSTYGKFLADGGXSGGAYDIIICDECHSTDATSIL-------------GIGTVLDQA
1sfjA           A--TITPQETLIQKINHRIDAITVDQVAEMITKLS-------FKLLVTYRTKLQGGYGQFTNDSYLNLIS
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1qhdA1          NLQRVFTVASIRSML-------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1g8yA           HRLHALGAHLSAEER-------------------QAVADGLLIQPLIGSLPNIMAPEWFDGLKRAAEGRR
1tmkA           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2gtlM1          CAHFNAQ---------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1tueA           DDATTTCWTYFDTYMRNALDG-------------------------------------------------
1l3aA           ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1oftA           THEWLRRAGLNRERILLLQAKDNAAALALSCEALRL--------GRSHTVVSWLEPLSRAARKQLSRAAQ
1heiB1          ----------------------------------------------------------------------
2gujA1          FEDFDVPE--------------------------------------------------------------
1xzpA1          EVTGRSFREDLLDTIFS-----------------------------------------------------
1dekA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           ALLKDAPVVLLDEATASLDPENETLIQRAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHK
1b0uA           ALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEGKTMVVVTHEMGFARHSSHVIFLHQGKIEEEGDPE
1q3hA           AVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTILVTSKMEHLRKADKILILHQGSSYFYGTFS
1sgwA           TLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSRE-ELSYCDVNENLHKY---------
1e69A           LFIKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVITHNKIVMEAADLLHGV----TMVNGVSA
1pf4A1          ALLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVIAHRLSTIEQADEILVVDEGEIIERGRH-
1l7vC           VVLQITPLLLLDEPXNSLDVAQQSALDKILSALCQGLAIVXSSHDLHTLRHAHRAWLLKGGKXLASGRRE
1m3eA1          KPREVREFNGQHFILEEAIRGDFALVKAWKADQAGNVTFRKSARNFNLPCKAAETTVVEVEEIVDIG---
1ji0A           ALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQGTTILLVEQALGALKVAHYGYVLETGQIVLEGKAS
1yvuA2          TKIFNSKGELVRYYLTSYPAFGEKLTEKAI-------GDVFSLLEKLGFKKGSKIVVHRDGRLYRD----
1ex6A           LFIAPPSVEDLKKRLEGRGTETEESINKRLSAATGAHDKVIVNDDLDKAYKLKDFIFAE-----------
1nijA1          RYLLDGVIALVDAVHADEQMNQFTIAQS--QVGYADRILLTKTDVAGEAEKHERLARINARAPVYTVTHG
2hydA2          ----------------------------------------------------------------------
1khbA1          CAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEAKIIM
1poiA           DKFKYIDNPFKPKVVAVPVPQVDVAIIHA-----------------------------------------
1jalA1          LDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPVLENIRSVGLDKEELQAIKSYNFLTLKPTMYIANVN
1t06A           LLGNRKDNAFSESKISDMLEMVKDTIHHSPTKSAMNNFLNTVAISYKAVEIAKEVGIVEVKRDNKKSSLL
1e9rA           ELFHWTTIATFDDLRGFLEGTLAESLFAGSNEAALTSARFVLSDKLP-----------------------
1jqjA2          MPIGQS----LPSHSVIVPRKGVIELMRMLDGG-DNPLRVQIGSNNIRAHVGDFIFTLVDGR--------
1qhlA           SASDRSKFYRLIEASGGISSAITRSLRDY-----------------------------------------
1rkbA           VLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDH--------------------------
1jjvA           PLLIENKLTALCDRILVVDVSPQTQLARSANFEQIQRIMNSQVSQQERLKWADDVINNDAELAQNLPHLQ
1bmfA3          RPPGREAYPGDVFYLHSRLLERAAGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLE-TELFYKGIRP
1udwA           LFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIV
2iqhA1          CVYGSAVASGYDFEREGYSLVGIDPFRL-----LQNSQVYSLIRPNENPAHSQLVWMACHSAAFEDLRVS
1grqA           ----RCDGAVAEGRETARGDRVAGMAAKQAYVVHEEYDVEVDTTHKESIECAWAIA--------------
1mjgM           MKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKDRMRGLTDETVDTFYSCNHVCIVTPERVGLCGAVS
1urjA           DAALALMAVFDEPPTDISAQDTAAARANAVGAYLARAAGLVGAMVFSTNSALHLTEVDDAG---------
1bgxT2          QLALIKELDLLGLARLEVPGYEADDVLASLAKKKEGYEVRILTADKDLYQLSDRIHVLHPEGYLITP---
1kgdA           VVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRLEEAVEL------------
2axpA1          EVXSNAGLHTYSWDTGQWSSDEAKDIIFLV----------------------------------------
1pv4A3          VLTGGVDANALHRPKRFFGAARNVEEGG---SLTIIATALIDTGSKXDEVIYEEFKGTGNXELHLSRK--
1q3tA           VVLPQAELKIF------LVASVDERAERRYKENIAKGIETDLETLKKEIAARDY---KDSHRETSP----
1mukA           VVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRHLNTPPRMGWLRAILRFLGAG---MVMTATGVAVDIYLE
1zp6A1          SLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDALQSAINALQSGRFR---------------------
1ffhA2          ELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDVGVTGLVLTKLDGDARAALSARHVTGKPIYFAGLEP
1l7lA           ----------------------------------------------------------------------
1ohcA1          LVGCYMVIYLGRTPEEAYRIETSYIPFRDAAYGSCYITLLDCFHAVK-----------------------
2yyeA2          DPVTSGGLLFTINKEKLEK-----IDETAKELEVNYWIIGETIAENVLE---------------------
1o7d.2          LPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQELLFSALVPAVGFSIYSVSQMPRDLVIQNEYLRARFDPN
1g6oA           SAARNIKESLIEGFKDLID-----------------XIVHINHHKQCDE---------------------
1qhdA1          ----------------------------------------------------------------------
2gx8A1          VLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMMLNIVDPGHNVEKVMVQKQLQEKVDAKKLNVHIHA
2gk3A1          DIGSNTFLLQNETFYQLKIKPNKEYVKNGGGLLXIGGYLSFXGIEA-----KANYKNTVLAEVLPVIXLD
1c4oA1          YRARNLVGFVLFPATHYLSPEGEEILKEIEKELWERVRYFEERGEV------------------------
2v3jA1          HLPTKCRKVTLSFDAPVIRVQDYIEKLDDDESICVFVGAXARGKDNFADEYVDEKVGLSNYPLSASVACS
1vplA           ALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGILVSSHNMLEVEFLCDRIALIHNGTIVETGTVE
1l1oA           ----------------------------------------------------------------------
1jb1A           AAXNFRAKSXGYDATKTFEKNLNHLIE-------------------------------------------
1iioA           DPFKSAEEVADTIVNK------------------------------------------------------
1xbtA1          SVVKL-----------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1s9hA           PLQDRMFKFELTRRLDHDFGKTKQEVKDFFRWAKDHVVEVEHEFYVKK----------------------
1n25A           KDYLKHCLERSEFLLEKRIIQIALLLMLIWYRPVAEFAQSIQSRIVEWKRLDKEFSLSVYQKMKFN----
1tljA           RTGIRMVHLLRESNTERVDKDKKTLVNVCNEVLARGKQKMNLLKD-------------------------
1d6jA           VYVDVPVEAPYEAPANKNYELPVQDAVKQIIDYLDTKG-YLPAKK-------------------------
1ii8.1          YLAGEISLLILDEPTPYLDEERRRKLITIMERYLKIPQVILVSHDEELKDAADHVIRISLENGSSKV---
1fl9A           AF--------------------------------------------------------------------
2f9hA1          LIFADAPTDEDDVIRNGVYLTPHQLPKIT-----IGTTIDYL----------------------------
1afrA           FISHGNTARQAKEHGDIKLAQICGTIAA-----DEKRHETAYTKIVEKLFEDPDGTVLAFADMMRKKIS-
1jbkA           ALERRFQKVFVAEPSVEDTIA-------------------------------------------------
1e6cA           AVLREREALYQDVAHYVVDATQAAIVCELMQTM-------------------------------------
1lw7A2          IKEYPFDVTILLKNN-------------------------------------------------------
1atrA1          TIAGLNVLRIINEPTAAAIAYGL-----------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           VGLLKPDLTLFLSTQFGDERYETVKFQ------EKVKQTFMKLLDKEIRKGDESITIVDVTNKGIQEVEA
1es6A2          LTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDCHSPASL----------------------------
1f2t.1          YLAGEISLLILDEPTPYLDEERRRKLITIMERYLKIPQVILVSHDEELKDAADHVIRI------------
1pgsA2          ----------------------------------------------------------------------
1zs3A1          EEFLKYHKFITEDPKAKYWTDEDSFIVDFQAQNMFITRAIKLANKEEKFALAAGVVEL------------
1g6hA           ALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAGITFLIIEHRLDIVLNIDHLYVMFNGQIIAEGRGE
1bs2A1          EKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLFKLT-HQVSSCYDVLWVAGQTEEL
1j1zA2          RL----NEIGGRHGVGRVDIVENRFVGMKSRGVTPGGTILYHARRAVESLTDREVLHQRDMLSPKYAELV
1i1qA           ----------------------------------------------------------------------
1f8xA           EALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLKVWATATYNNDLNGIKTNDIMLGVYIPDEEDVGLGM
1t3wA           LLELRQEELIARERTHGLSNEERLELWTLNQEL-------------------------------------
1cr0A           AYMRGCDVIILDHIS--IRKMIDNLMTKLKGFAKSTGVVLVVICHLKDLRASDTIIALERNQLVLVRILK
1mm8A           EF----PELLAIEDTTSLSYRHQVAEELGKLGSIQDKSRGWWVHSVLLLATTFRTVGLLHQEWWMRPDDP
1ak2A1          ITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSGIHSAIDASQTPDVVASILAAF--------------
1jqjA3          ----------------------------------------------------------------------
1f46A           HIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKD-----------------------------------
2gtlM1          ----------------------------------------------------------------------
2qgmA1          KXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVTEXGFTNFAXEEDWGNGLKLNEYIQTGKGNPREFLKL
1vhhA           Y---NPDIIFKDEENTGADRLMTQRCKDKLNALAIPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSD
1viaA           SKYEQKANFILNIENKNIDELLSEIKK-------------------------------------------
1dnpA2          QNGLQIALAEKGIPLLFREVDDFVASVEIVVCAENSVTHLFYNYQYEVNRARDVEVERALRNVVCEGFDD
1ckeA           -RDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVSVNFERLLAEIKLVPAADALVLDSTTLSIEQ----
1ni3A1          LSIIVDELLIKDA---------------------------------------------------------
1dhyA1          ADQRAWRIAVQPGELDDLAYAGLEVDDAAALERMARQAGVAFTRGD-EALMQQRKVMGLLCLQDPFGLPL
1zbsA1          GQXPE---GLCEAFLQEYGLTSADIIESVYRKPFPNRFLAGFSPFIAQHLDIPAVYSLVQN---------
1d8jA           EAVNNPKIEVIDGKYAFKPKYNV-----------------------------------------------
3cddA2          LAK-QRGVLLTSDTFGNLVI--------------------------------------------------
1w1wA           LFYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLFIVISLKNTMFEKSDALV--------------
1pf4A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1np6A           DGAGHRPEELVIDRHVIAVA--SDVPLNLDVALLDINDVEGLADFVVE----------------------
2ancF1          RLRMSRQKQRHDALISKLL---------------------------------------------------
1v47A1          DERLD-LENLATGAFFPVKGFMTREEALSVTGEVWTIPILLQFREKPRVGPGNTVALLHGGERVALL---
1oy5A           AVSRVLPGVLSEPYPVYTRPRE------------------------------------------------
1cd5A           LQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENI-----------------------------------
1e3mA2          -----XEGVANVHLDALEHGDTIAFXHSVQDGAASKSYGLAVAALAGVPKEV------------------
2fggA1          ARLDP-----ADEPVAQIGDELA--IARALSDL--ANQLFALTSSDIEAS--------------------
3cddA1          IGRYRPLIIVNEEVTAEGAAKRGQWERQRSIGKSNXAEYTVTGWRIPQWNINTLVPVIDEIXGLDEE---
1uouA3          ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1sbxA           FVVGGEKRLCL---PQILNSVLRDFSLQQINAVCDHIYCSRCTADQLEILKVILPFSAPSCGLITKTDAE
1tueA           ----------------------------------------------------------------------
1gm5A1          ------EIPNLPEARKRYRIQKSLEMIEKLRSW--FLIDYL-----------------------------
1l3aA           VLKVEPL---PDGSGHFFNLSVQNKLINLDENIYIAEFAVLVSA-------FNFVMPYLLGWHTAVNSFK
2vgmA3          EYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESGGKALVLSTLHEELDQLTGIACILKYPLPD-----
1e2hA           SMTPQAVLAFVALIPPTLPGTNIVLLAKRQRPGERLDLAMLAAIRRVYGLLANTVRYLQCGGSWREDWGQ
2vnuD1          ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1bccF           YLEPYLKEVI------------------------------------------------------------
1yj5A2          PTLAEGFLEILEIPFRLQEHLDPAL---------------------------------------------
1odfA           KIKLPVDIFILEGWFLGFNPILQGIENNDLLTGDMVDVNAKLFFYSDLLWRNPEI----------KSLGI
2pa7A1          I----