[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV55525.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ffyA1.bssp"
#ERROR : Can't open dsspfile "1ffyA2.bssp"
#ERROR : Can't open dsspfile "1h78A.bssp"
#ERROR : Can't open dsspfile "1ffyA3.bssp"
#ERROR : Can't open dsspfile "1n1bA2.bssp"
#ERROR : Can't open dsspfile "1h3nA2.bssp"
#ERROR : Can't open dsspfile "1ileA2.bssp"
#ERROR : Can't open dsspfile "1ileA3.bssp"
#ERROR : Can't open dsspfile "1h3nA3.bssp"
#ERROR : Can't open dsspfile "1ileA1.bssp"
#ERROR : Can't open dsspfile "1f9dA.bssp"
#ERROR : Can't open dsspfile "1j5qA1.bssp"
#ERROR : Can't open dsspfile "1rqgA2.bssp"
#ERROR : Can't open dsspfile "1irxA2.bssp"
#ERROR : Can't open dsspfile "1gaxA3.bssp"
#ERROR : Can't open dsspfile "1a8hA2.bssp"
#ERROR : Can't open dsspfile "1iq0A2.bssp"
#ERROR : Can't open dsspfile "1f4lA2.bssp"
#ERROR : Can't open dsspfile "1euqA2.bssp"
#ERROR : Can't open dsspfile "1rqgA1.bssp"
#ERROR : Can't open dsspfile "1gaxA5.bssp"
#ERROR : Can't open dsspfile "1gaxA2.bssp"
#ERROR : Can't open dsspfile "1a1xA.bssp"
#ERROR : Can't open dsspfile "1pzdA1.bssp"
#ERROR : Can't open dsspfile "1f4lA1.bssp"
#ERROR : Can't open dsspfile "1x6mA.bssp"
#ERROR : Can't open dsspfile "1li5A2.bssp"
#ERROR : Can't open dsspfile "1j1uA.bssp"
#ERROR : Can't open dsspfile "1qmyA.bssp"
#ERROR : Can't open dsspfile "1jfaA.bssp"
#ERROR : Can't open dsspfile "1a8hA1.bssp"
#ERROR : Can't open dsspfile "1h3nA1.bssp"
#ERROR : Can't open dsspfile "2p84A1.bssp"
#ERROR : Can't open dsspfile "2bl7A1.bssp"
#ERROR : Can't open dsspfile "1d2rA.bssp"
#ERROR : Can't open dsspfile "1fl7B.bssp"
#ERROR : Can't open dsspfile "1c4kA1.bssp"
#ERROR : Can't open dsspfile "2d6yA2.bssp"
#ERROR : Can't open dsspfile "1edzA2.bssp"
#ERROR : Can't open dsspfile "1bs2A2.bssp"
#ERROR : Can't open dsspfile "1nzjA.bssp"
#ERROR : Can't open dsspfile "1a14N.bssp"
#ERROR : Can't open dsspfile "1o5tA.bssp"
#ERROR : Can't open dsspfile "1ileA3.bssp"
#ERROR : Can't open dsspfile "1rqgA2.bssp"
#ERROR : Can't open dsspfile "1irxA2.bssp"
#ERROR : Can't open dsspfile "1gaxA3.bssp"
#ERROR : Can't open dsspfile "1a8hA2.bssp"
#ERROR : Can't open dsspfile "1iq0A2.bssp"
#ERROR : Can't open dsspfile "1f4lA2.bssp"
#ERROR : Can't open dsspfile "1euqA2.bssp"
#ERROR : Can't open dsspfile "1li5A2.bssp"

## Summary of PDB Search
:948
    3e-66  33%  1ffyA1 [a.27.1.1] ISOLEUCYL-TRNA SYNTHETASE A:645 -- 917
    7e-54  40%  1ffyA2 [b.51.1.1] ISOLEUCYL-TRNA SYNTHETASE A:201 -- 394
    1e-50   9%  1h78A  [c.7.1.3] ANAEROBIC RIBONUCLEOTIDE-TRIPHOSPHATE REDUCTASE
    4e-45  26%  1ffyA3 [c.26.1.1] ISOLEUCYL-TRNA SYNTHETASE A:1 -- 200 A:395 -- 644
    1e-43  14%  1n1bA2 [a.128.1.3] (+)-BORNYL DIPHOSPHATE SYNTHASE A:271 -- 598
    1e-43  26%  1h3nA2 [b.51.1.1] LEUCYL-TRNA SYNTHETASE A:226 -- 417
    2e-42  37%  1ileA2 [b.51.1.1] ISOLEUCYL-TRNA SYNTHETASE A:198 -- 386
    1e-41  28%  1ileA3 [c.26.1.1] ISOLEUCYL-TRNA SYNTHETASE A:1 -- 197 A:387 -- 641
    9e-40  18%  1h3nA3 [c.26.1.1] LEUCYL-TRNA SYNTHETASE A:1 -- 225 A:418 -- 686
    1e-37  23%  1ileA1 [a.27.1.1] ISOLEUCYL-TRNA SYNTHETASE A:642 -- 821
    1e-36  11%  1f9dA  [a.102.1.2] ENDO-1,4-BETA-GLUCANASE F
    6e-35  12%  1j5qA1 [b.121.2.3] MAJOR CAPSID PROTEIN A:25 -- 221
    1e-34  16%  1rqgA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:1 -- 138 A:174 -- 396
    2e-31  10%  1irxA2 [c.26.1.1] LYSYL-TRNA SYNTHETASE A:3 -- 319
    3e-31  20%  1gaxA3 [c.26.1.1] VALYL-TRNA SYNTHETASE A:1 -- 189 A:343 -- 578
    6e-31  18%  1a8hA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:1 -- 348
    9e-31  11%  1iq0A2 [c.26.1.1] ARGINYL-TRNA SYNTHETASE A:97 -- 466
    1e-30  14%  1f4lA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:4 -- 140 A:176 -- 388
    4e-30   8%  1euqA2 [c.26.1.1] GLUTAMINYL-TRNA SYNTHETASE A:8 -- 338
    1e-29  11%  1rqgA1 [a.27.1.1] METHIONYL-TRNA SYNTHETASE A:397 -- 606
    5e-29  21%  1gaxA5 [a.27.1.1] VALYL-TRNA SYNTHETASE A:579 -- 796
    5e-28  28%  1gaxA2 [b.51.1.1] VALYL-TRNA SYNTHETASE A:190 -- 342
    2e-27  13%  1a1xA  [b.63.1.1] HMTCP-1
    8e-26  15%  1pzdA1 [b.1.10.3] COATOMER GAMMA SUBUNIT A:604 -- 762
    1e-25  15%  1f4lA1 [a.27.1.1] METHIONYL-TRNA SYNTHETASE A:389 -- 548
    6e-25  11%  1x6mA  [b.88.1.4] GLUTATHIONE-DEPENDENT FORMALDEHYDE-ACTIVATING
    3e-23  12%  1li5A2 [c.26.1.1] CYSTEINYL-TRNA SYNTHETASE A:1 -- 315
    5e-23  12%  1j1uA  [c.26.1.1] TYROSYL-TRNA SYNTHETASE
    3e-21   6%  1qmyA  [d.3.1.2] PROTEASE
    5e-21  12%  1jfaA  [a.128.1.5] TRICHODIENE SYNTHASE
    1e-19  16%  1a8hA1 [a.27.1.1] METHIONYL-TRNA SYNTHETASE A:349 -- 500
    3e-18  20%  1h3nA1 [a.27.1.1] LEUCYL-TRNA SYNTHETASE A:687 -- 814
    6e-17   4%  2p84A1 [b.172.1.1] ORF041 A:3 -- 135
    1e-14  11%  2bl7A1 [a.29.8.2] ENTEROCINE A IMMUNITY PROTEIN A:3 -- 82
    7e-14   8%  1d2rA  [c.26.1.1] PROTEIN (TRYPTOPHANYL TRNA SYNTHETASE)
    2e-13  12%  1fl7B  [g.17.1.4] FOLLICLE STIMULATING PROTEIN BETA CHAIN
    1e-12   8%  1c4kA1 [c.23.1.4] PROTEIN (ORNITHINE DECARBOXYLASE) A:1 -- 107
    3e-11  11%  2d6yA2 [a.121.1.1] PUTATIVE TETR FAMILY REGULATORY PROTEIN A:75 --
    4e-09  20%  1edzA2 [c.58.1.2] 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE A:3
    1e-07  17%  1bs2A2 [c.26.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:136 -- 483
    1e-05  10%  1nzjA  [c.26.1.1] HYPOTHETICAL PROTEIN YADB
    4e-04   9%  1a14N  [b.68.1.1] NEURAMINIDASE
    5e-04  37%  1o5tA  [c.26.1.1] TRYPTOPHANYL-TRNA SYNTHETASE
    2e-39  27%  1ileA3 [c.26.1.1] ISOLEUCYL-TRNA SYNTHETASE A:1 -- 197 A:387 -- 641(query 14->247)
    6e-18  22%  1rqgA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:1 -- 138 A:174 -- 396(query 50->199)
    2e-09  10%  1irxA2 [c.26.1.1] LYSYL-TRNA SYNTHETASE A:3 -- 319(query 529->655)
    6e-30  25%  1gaxA3 [c.26.1.1] VALYL-TRNA SYNTHETASE A:1 -- 189 A:343 -- 578(query 15->235)
    1e-19  22%  1a8hA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:1 -- 348(query 50->199)
    3e-12   8%  1iq0A2 [c.26.1.1] ARGINYL-TRNA SYNTHETASE A:97 -- 466(query 442->661)
    3e-23  18%  1f4lA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:4 -- 140 A:176 -- 388(query 49->220)
    8e-14  11%  1euqA2 [c.26.1.1] GLUTAMINYL-TRNA SYNTHETASE A:8 -- 338(query 33->266)
    2e-22  15%  1li5A2 [c.26.1.1] CYSTEINYL-TRNA SYNTHETASE A:1 -- 315(query 407->665)
:948

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxNTYKETMNLPKTDFAMRANLPESEPKRLAKWEEEHIYEQVLEKNKDGKPFILHDGPPYANGPIHIGHA
1ffyA1          ----------------------------------------------------------------------
1ffyA2          ----------------------------------------------------------------------
1h78A           ----LVDLKGMLENGFKLG-NAQIETPKSLSPYVKRTYAKHIEDAEKWQIADALN------YAQSKTEKD
1ffyA3          ----YEKTLLMPKTDFPMRGGLPNKEPQIQEKWDAEDQYHKALEKNKGNETFILHDGPPYANGNLHMGHA
1n1bA2          -----PLIFELAKLNFNIIQATHQQELKDLSRWSRLCFPEKLPFVRDRLWAVGMFEPHQHGYQRKMAATV
1h3nA2          ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1h3nA3          ------------------KYNPHAIEAKWQRFWEEKGFMK-AKDLPGGRGKQYVLVMFPYPSGDLHMGHL
1ileA1          ----------------------------------------------------------------------
1f9dA           --QLTSAYGTSMLYGMHWILDVDNWYGFGARADGTSKPSYINTFQRGEQESTWETIPQPCWD---EHKFG
1j5qA1          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1irxA2          --------------------------------WADYIADKIIRERGE--KEKYVVESGITPSGYVHVGNF
1gaxA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------RRPGVVLVEHTSVNPNKELHVGHL
1f4lA2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1li5A2          -------------------------------KIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHG
1j1uA           -------------------------EMIKRNTSEIISEEE--LREVLKKDEKSAYIGF-EPSGKIHLGHY
1qmyA           ---------------------------------------------------------------ELTLYNG
1jfaA           ----CVGASLWPKEQFNERSLFLEITSAIAQMENNDLMSFYKEFDDERDQISLVK--NYVVSDEISLHEA
1a8hA1          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1d2rA           ---------------------------------------------------------GIQPSGVITIGNY
1fl7B           ----------------------------------------------------------------------
1c4kA1          -------------------------------------------------------------------SSL
2d6yA2          ----------------------------------------------------------------------
1edzA2          --------------SMGFRYDLRVIEDKD---FLEEAIIQ--ANGDDSVNGIMVYFPVF--------GNA
1bs2A2          --------------------------------------------KLVENKKVIIEFSSPNIAKPFHAGHL
1nzjA           ---------------------------------------------------------APSPSGELHFGSL
1a14N           ----------------------------------------------------------------------
1o5tA           --------------------------------------MNQVLDAYENKKPFYLYTGRGPSSEAMHVGHL
1ileA3          -------------FKEVGEPNFPKLEEEVLAFWKREKIFQKSVENRKGGPRYTVYEGPPTANGLPHVGHA
1rqgA2          -------------------------------------------------VRYMVTSALPYANGPIHAGHL
1irxA2          ----------------------------------------------------------------------
1gaxA3          --------------DLPKAYDPKSVEPKWAEKWAKNPFVAN---PKSGKPPFVIFMPPPNVTGSLHMGHA
1a8hA2          -------------------------------------------------KVFYVTTPIYYVNAEPHLGHA
1iq0A2          ----------------------------------------------------------------------
1f4lA2          ------------------------------------------------AKKILVTCALPYANGSIHLGHM
1euqA2          --------------------------------FIRQIIDE---DLASGKHTTVHTRFPPEPNGYLHIGHA
1li5A2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FNKILKDFVNKSHAQRGFFTPYVPGWDCHGQPIEHMVEKTLGPDKMAKIDQPTLRRLCREWAEKYVDVQR
1ffyA1          ----------------------------------------------------------------------
1ffyA2          ----------------------------------------------------------------------
1h78A           VYDAFQAYEYEVNTLFSSNTPFVTITFGTGTDWTE------------RMIQKAILKNRIKG--LGRDGIT
1ffyA3          LNKILKDFIVRYKTMQGFYAPYVPGWDTHGLPIEQALTKKGV--DRKKMSTAEFREKCKEFALEQIELQK
1n1bA2          LATVIDDIYDVYGTLDELFTDTFKRWDTESITRLPYYMQLCYWNYISDAAYDILKEHGFFCLQYLRKSVV
1h3nA2          ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1h3nA3          KNYTMGDVLARFRRMQGYEVLHPMGWDAFGLPAENAALK--------------FGVHPKDWTYANIRQAK
1ileA1          ----------------------------------------------------------------------
1f9dA           GQYGFLDLFTKDTGTPAKQFKYTNAPDADARAVQATYWADQWA---------------KEQGKSVSTSVG
1j5qA1          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1irxA2          RELFTAYIVGHALRDKGYEVRHIHMWDDYDRFRKVPRNVPQEWKDYLISEVPDPWGCHESYAEHFMRKFE
1gaxA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          RNIALGDAIARILAYAGREVLVLNYIDDTGRQAAETLFALRHYGLTWDGKEKYDHFAGRAYVRLHQDPEY
1f4lA2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1a1xA           --------------------------EDVGAPPDHLWVHQEG------IYRDEYQRTWVAVVEEETSFLR
1pzdA1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1li5A2          RTFVAFDVVARYLRFLGYKLKYVRNITDIDDKIIKRANE--------------NGESFVAMVDRMIAEMH
1j1uA           LQIKKMID----LQNAGFDIIILLADLHAYLNQKG----------------------ELDEIRKIGDYNK
1qmyA           EKKTFYSRPNNHDNAWLFRYVEEPFFDWVYSSPENLTLEAI--------------KQLEDLTGLELHEGG
1jfaA           LEKLTQDTLHSSKQMVAVFPQVMDTIECFMHGYVTWHLCD------------------------------
1a8hA1          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
2p84A1          ---------------------------------------------------------TDYQKGMSYAEQQ
2bl7A1          ----------------------------------------------------------------------
1d2rA           IGALRQFVELQH------------EYNCYFCIVD---------QHAITVWQ------DPHELRQNIRRLA
1fl7B           ----------------------------------------------------------------------
1c4kA1          KIASTQEARQYFDTDRVVVDAVGSDFTDVGAVIAMDY--------ETDVIDA------ADATKFGIPVFA
2d6yA2          ----------------------------------------------------------------------
1edzA2          QDQYLQQVVCKEKDVEGLNHVYYQNLY-HNVRYL------------------------------------
1bs2A2          RSTIIGGFLANLYEKLGWEVIRMNYLGDWGKQFG------------------------------------
1nzjA           IAALGSYLQ-----ARARQGRWLVRIEDIDPPREV---------------------------PGAAETIL
1a14N           ----------------------------------------------------------------------
1o5tA           FTKWLQDVFNV-----------------------------------------------------------
1ileA3          QARSYKDLFPRYKTMRGYYAPRRAGWDTHGLPVELEVEKKLGLKSIEAYGIERFNQACRESVFTYEKEWE
1rqgA2          AGAYLPAIFVRYLRLKGEDVVFICGTDEHGTPISFRALKEGRSPRE--------------IVDEFHEQIK
1irxA2          ----------------------------------------------------------------------
1gaxA3          LDNSLQDALIRYKRMRGFEAVWLPGTDHAGIATQVVVERLLLKEGKHDLGREKFLERVWQWKEESGGTIL
1a8hA2          YTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQA--------------AGEDPKAFVDRVSGRFK
1iq0A2          ----------------------------------------------------------------------
1f4lA2          LEHIQADVWVRYQRMRGHEVNFICADDAHGTPIMLKAQQLGITPEQ--------------MIGEMSQEHQ
1euqA2          KSICLNFGIAQDYKGQCNLRFDDTNPVKEDIEYVESIKNDVEW--------------LGFHWSGNVRYSS
1li5A2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EGFKRLGVNADWEHPYLTFTPNYEAGNVEVFKRMYLDGSVYRGRKPIHWCKRCHTALAEAEIEYSDETSP
1ffyA1          ----------------------------------------------------------------------
1ffyA2          -----------------------------------------------------------------DKRSA
1h78A           PIFPKLVMFVEEGVNLYKDDPNYDIK-QLALECASKRMYPDIISAKNNKA---------ITGSSVPVSPM
1ffyA3          KDFRRLGVRGDFNDPYITLKPEYEAAQIRIFGEMADKGLIYKGKKPVYWSPSSESSLAEAEIEHDWRTKK
1n1bA2          DLVEAYFHEAKWYHGYTPSLDEYLNIAKISVASPAIISPTYFTFANASHDTAVIDSLY----QYHDILCL
1h3nA2          --------------------------------------------------------------------SE
1ileA2          -----------------------------------------------------------------EIQDP
1ileA3          ----------------------------------------------------------------------
1h3nA3          ESLRLMGILYDWDREVTTCEPEYYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLANEQVVEGRCWRH
1ileA1          ----------------------------------------------------------------------
1f9dA           KATKMGDYYSFFDKYFRKIGQPSQAGTGDAAHYLLSWYYAWGGGIDSTWSWIIGSSHNHFGYQNFAAWVL
1j5qA1          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1irxA2          EEVEKLGIEVDLLYASELYKRGEYSEEILAFEKRDKIMEILNKYREIAKQPPLPENWWPAMVYCPEHRRE
1gaxA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          ERLQPAIEEVLHALERGELREEVNRILLAQMATMHALNARYDLLVWESDIVRAGLLQKALALLE------
1f4lA2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1a1xA           ARVQQIQVPLGDAARPSHLLTSQLP-----LMWQLYPEERYMDNNSRLWQIQHHLMVRGVQ---------
1pzdA1          --------------VAATRQEIFQE-QLAAVPE-------FQGLGPLFKSSPEPVALTESETEYVIRCTK
1f4lA1          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1li5A2          KDFDALNILRPD---MEPRATHHIAEIIELTEQLIAKGHAYVADNGDVMFDVPTDPTYGVLSRQKRNPMD
1j1uA           KVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKRARRSMELIAREDENPKVAEVIYPIMQVNDI-
1qmyA           PPALVIWNIKRPSEVCVVDGTDMSLADFGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPS------
1jfaA           --------RRYRLSEIYEKVKEEKTEDAQKFCKFYEQAANVGAVSPSEWAYPPVAQLAN-----------
1a8hA1          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
2p84A1          DFDMGFTI--WFDHIEDLDLIEKDGTINRIVMMSTGLKDKNVKEIYDIVRNLYGELYVVEWLDGSFVLTE
2bl7A1          ----------------------------------------------------------------------
1d2rA           ALYLAVGIDPTQATLFIQS----------EVPAHAQAAWMLQCIVYIGELERMTQFKEKS----------
1fl7B           ----------------------------------------------------------------------
1c4kA1          VTKDAQAISADEL-KKIFHIIDLEFDATVNAREIETAVNNY-----------------------------
2d6yA2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1nzjA           RQLEHYGLHWDGDVLWQS---QRHDAYREALAWLHEQGLSYYCSIGGIYDGHCRVLHHGPDNAAVRIRQQ
1a14N           ----------------------------------------------------------------------
1o5tA           ----------------------------------------------------------------------
1ileA3          AFTERIAYWVDLEDAYATLEPTYIESIWWSLKNLFDRGLLYRDHKVVPYCPRCGTPLSSHEVALGYPHCW
1rqgA2          ITFQRAKISFDFFGRT--ELPIHYKLSQEFFLKAYENGHLVKKVTKQAYCEHDKMFLPD-----------
1irxA2          ----------------------------------------------------------------------
1gaxA3          KQLKRLGASADWSREAFTMDEKRSRAVRYAFSRYYHEGLAYRAPRLVNWCPRCETTLSDLEVETCSRCGT
1a8hA2          RAWDLLGIAYDDFIR--TTEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTE-----------
1iq0A2          ----------------------------------------------------------------------
1f4lA2          TDFAGFNISYDNYHS--THSEENRQLSELIYSRLKENGFIKNRTISQLYDPEKGMFLPDRFVVSGATPVM
1euqA2          DYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENLALFEKMRAGGFEEGKA
1li5A2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SIFVKFKMDIMPGMFETAGAAGDAYVLIWTTTPWTLPANTAVSLAPDADYVMVQADGSNMIMARELVEQV
1ffyA1          ----------------------------------------------------------------------
1ffyA2          SIYVAFNVKDDKGVVDA-----DAKFIIWTTTPWTIPSNVAITVHPELKYGQYNVNGEKYIIAEALSDAV
1h78A           GCRSFLSVWK------------DSTGNEILDGRNNLGVVTLNLPRIALDSYIGTQFNEQKFVELFNERMD
1ffyA3          PVIFRATPQWFASISKVRQDILDAIENTNFKVNWGKTRIYNMVRDRGEWVISRQRVWGVPLPAENGEIIM
1n1bA2          AGIILRLPDIQCYMKETNASEEEAVEHVKFAAGYPFPVAGAANIGRVAQFIYLHGDGFSKTIAGLLFEPY
1h3nA2          GAEILFPV-----------EGKEVRIPVFTTRPDTLFGATFLVLAPEHPLTLELAAPEKREEVLAYVEAA
1ileA2          SVYVRFPLKEPKKL-----GLEKASLLIWTTTPWTLPGNVAAAVHPEYTYAAFQVGDEALILEEGLGRK-
1ileA3          ----------------------------------------------------------------------
1h3nA3          EDTPVEKRELEQWYL------------RITAYAERLLKDLEGLNWPEKVKAMQRAWIGRLRDW-------
1ileA1          ----------------------------------------------------------------------
1f9dA           STDANFKPKLQSAEGAIAGGATNSWNGRYEAVPSTFYGMGYVENPVYADPGSN-------TWFGMQVWSM
1j5qA1          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1irxA2          AEIIEWDGGWKVKYKCPEGHEGWVDIRSGNVKLR------------------------------------
1gaxA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1gaxA2          ---------------------GGGFIEIATVRPETVFADQAIAVHPEDERY------------RHLLGKR
1a1xA           ----------------------------------------------------------------------
1pzdA1          HTFTDHQFDCTNTLNDQ--TLENVTVQMEPSEAYYVPARSLPYNQPGTCYTLVALPKEDPTAVACTFSCV
1f4lA1          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1li5A2          FVLWKMSKEGEPSWPSPWG---------------------------------------------------
1j1uA           ---HYLGVDVAVG--------GMEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGNFIAVDDSPEEIRAK
1qmyA           ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
2p84A1          FYNGGYDHYI------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
2d6yA2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1nzjA           HPVTQFTDQLRGIIHADEKLAREDFIIHRRDGLFA-----------------------------------
1a14N           ----------------------------------------------------------------------
1o5tA           ----------------------------------------------------------------------
1ileA3          RCSTPLMYYATESWFIKNTLFKDELIRNNQEIHWVPP---------------------------------
1rqgA2          ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1gaxA3          PIEYAIFPQWWLRMRPLAEEVLKGL---------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1f4lA2          RDSEHFFFDL------------------------------------------------------------
1euqA2          CLRAKIDMASPFVLYRIKFAEHHQTGNKWCIYPMYDFTHCISDALEGITHSLCTLE--------------
1li5A2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AEIAGWESYDLVRGEDGEPVALKGREFTGLTYTCPVRQDLKGTIIYGDHVTLDSGTGAVHTAPGHGQDDY
1ffyA1          ----------------------------------------------------------------------
1ffyA2          AEALDWDKASIKLEKE-----YTGKELEWVVAQHPF-LDRESLVINGDHVTTDAGTGCVHTAPGHGEDDY
1h78A           LCFEALMCRI-SSLKGVKATVAPILYQEGAFGVRLKPDDDIIELFKNGRSSVSLGYIGIHELNILVGRDI
1ffyA3          TKETVNHVADLFAEHGSNIWFEREAKDLLPEGFTHPGSPNGTFTKETDIMDVWFDSGSSHRGVLETRPEL
1n1bA2          A---------------------------------------------------------------------
1h3nA2          KRKTEIERQAEGR--------EKTGVFLGAYALNPA-TGERIPIWTADYVLFGYGTGAIMAVPAHDQRDY
1ileA2          -----------LLGEGTQVLKFPGKALEGLPYTPPYPQALEKGVVLADYVSQEDGTGIVHQAPAFGAEDL
1ileA3          ----------------------------------------------------------------------
1h3nA3          ---------------------------------LISRQRYWGTPIPMVHC----------------EACG
1ileA1          ----------------------------------------------------------------------
1f9dA           QRVA-------------ELYYKTGDARAKKL----------------LDKWAKWINGEIKFNADGT----
1j5qA1          ----------------------------------------------------------RYTNFAIEQQTI
1rqgA2          -------------------------------------LRLKGEDVVFICGTDEHGTPISFRALKEGRSPR
1irxA2          ----------------------------------------------------------------------
1gaxA3          -------------------------------------------QVVVERLLLKEGKTRHDLGREKFLERV
1a8hA2          -----------------------------------------------------YVNAEPHLGHAYTTVVW
1iq0A2          ----------------------------------------------------------------------
1f4lA2          -------------------------------------QRMRGHEVNFICADDAHGTPIMLKAQQLGITPE
1euqA2          -----------------------------------------------------------NFIRQIIDEDL
1rqgA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1gaxA2          ARI--------------------------------PLTEVWIPILADPAVEKDFGTGALKVTPAHDPLDY
1a1xA           ----------------------------------------------------------------------
1pzdA1          MKFTVKD---------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1j1uA           IKKA-YCPAGVVEGNPIMEIAKYFLTIKRPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKI
1qmyA           ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
2d6yA2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1a14N           ----------------------------------------------------------------------
1o5tA           ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LVALEFDVPLLMPVDDNGVLTDEAGPFAGLDVDEANPVIIEWLRERGTLVAQKEILHSYPHCWRCHEPVI
1ffyA1          ----------------------------------------------------------------------
1ffyA2          IVGQQYELPVISPIDDKGVFTEEGGQFEGMFYDKANKAVTDLLTEKGALLKLDFITHSY-----------
1h78A           GREILTKMNAHLKQRTGFAFSLYSTPAENLCYRFCKLDTEKYGSVKD-------VTDKGWYTNSFHVSVE
1ffyA3          SFPADMYLEGSDQYRGWFNSSITTSVATRGVSPYKFLLSHGFVMDGEGKKMSKSLGN-------------
1n1bA2          ----------------------------------------------------------------------
1h3nA2          EFARKFGLPIKKVIYEEPGIMVNSGPFDGTESEEGKRKVIAWLEEKGLGKGRVT----------------
1ileA2          ETARVYGLPLLKTVDEEGKLL--VEPFKGLYFREANRAILRDLRGRGLLFKEESYLHSY-----------
1ileA3          ------------------------KNLFDRGLLYRDHKVVPYCPRCGTPLSSHEVALGYPHCWRCSTPLM
1h3nA3          VVPVEEELPVLLP-DLKDVEDIRPKGKSPLEAHP------EFYET--------TCPKCGGPAKRDTDTMD
1ileA1          ----------------------------------------------------------------------
1f9dA           -----FQIPSTI---DWEGQPD---TWNPTQGYTGNANL---------HVKVVNYGTDLGCASSLANTLT
1j5qA1          NGSVGFGNKVSTQISRNGDLITDIV----------VEFVLTKGGNGGTTYYPAEELLQDVELEIGGQR-I
1rqgA2          EIVDEFHEQIKITFQRAKISFDFFGRTELPIHYKLSQEFFLKAYENGHLVKKHDKMFLPDRFAICGRPIS
1irxA2          ----------------------------------------------------------------------
1gaxA3          WQWKEESGGTILKQLKRLGASRAVRYAFSRYYHEGLAYRAPRLVNWCPRCETTLSDLEVETCSRCGTPIE
1a8hA2          HRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAFVDRVSGRFKR-----AWDLLGIAYDDFIRTTEERH
1iq0A2          ----------------------------------------------------------------------
1f4lA2          QMIGEMSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFIKNREKGMFLPDRFVVSGATPV
1euqA2          ASGKHTTVHTRFPPEPNGYLH----------IGHAKSICLNFGQDYKGQCNLRFDDTNPVKEDIEYVESI
1rqgA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1gaxA2          EIGERHGLKPVSVINLEGRMEGERVPLRGLDRFEARRKAVELFREAGHLVKEEDYTIA------------
1a1xA           ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
1x6mA           ----------------DTSGVKIHPAVDNGIKPAQPGFAGGTLHCKRVAVRAQTAHNHVCGCTKCWKPEG
1li5A2          ----------------------------------------------------------------------
1j1uA           LE--------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
2d6yA2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1a14N           --------------------------------------------------------QESECVCHNGVCPV
1o5tA           ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1li5A2          --------------------------------------------------------DVVARYLRFLGYKL


                         .         .         +         .         .         .         .:490
query           FRATDQWFVSMDKNSLRENALKAIENDVEWIPAWASNRIGSMVADRPDWCISRQRSWGVPIPVFKCAKCG
1ffyA1          ----------------------------------------------------------------------
1ffyA2          ----------------------------------------------------------------------
1h78A           ENITPFEKISREAPYHFIAT----GGHISYVELPDMKNNLKGLEAVWDYAAQHLDYFGVNMPVDKCFTMN
1ffyA3          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1ileA3          YYATESWFIKNTLF--KDELIRNNQEIHWVPPHIKEGRYGEWLKNLVDWALSRNRYWGTPLPIWVCQACG
1h3nA3          TFFDSSWYYLRYTDPHNDRLPFDPEKANAWMPVDQYIG---------GVEHAVLHLLYSRFFTKFLHDL-
1ileA1          ----------------------------------------------------------------------
1f9dA           YYAAKSGDETSRQNAQKDAMWNN-YSDSKGISTVEQRGDYHRFLDQEVFVPA--GWTGKM-------PNG
1j5qA1          DKHYNDWFRTYDAL---------------FRMNDDRYNYRRMTDWVNNELVGAQKRFYVPLIFFFNQTPG
1rqgA2          FRDSAHYYIKMQDF--AERLKRWIE-KQPWKPNVKNMVLSWIEEGLEERAITRDLNWGIPVPLDEEDMKG
1irxA2          ----------------------------------------------------------------------
1gaxA3          YAIFPQWWLRMRPLAEEVLKGL-RRGDIAFVPERWKKVNMDWLENVKDWNISRQLWWGHQIPAWYCEDCQ
1a8hA2          KKVVQ---LVLKKVYEAGDIYYGEY-EGLYCVSCERFYTEKELVEGLCPIHGRPVERRKEGNYFFRMEKY
1iq0A2          ----------------------------------------------------------------------
1f4lA2          MRDSEHFFFDLPS--FSEMLQAWTRSGALQEQVANKMQEWFESGLQQWDISRDAPYFGFEIPNAPGKYFY
1euqA2          KNDVEWLGFHWSGNVRYSSDYFDQLHAYAI---ELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDR
1rqgA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
1x6mA           AIFSQVAVVGRDA-------------LEVLEGAEKLEIVNAEAPIQRHRCRDCGVHMYGRIENRDHPFYG
1li5A2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1fl7B           --------------------------IAIEKEECRFCISINTAWCA-GYCYTRDLVYKDPARPKIQKTCT
1c4kA1          ----------------------------------------------------------------------
2d6yA2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1a14N           VFTDGSATGPAETRIYYFKEGKILKWEPLAGTAKHIEECSCYGERAEITCTCRDNWQGSNRPVIRIDPVA
1o5tA           ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          ---------------------GLLQKALALLEQSPHVFRPREGKYAGALVMDASPVIPGLEDPFFVLLRS
1f4lA2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1li5A2          KYVRNITDIDDKIIKRANENGESFVAMV-DRMIAEMHKDFDALNILRPDMEPRATHHIAEIIELTEQLIA


                         *         .         .         .         .         +         .:560
query           STVANEQTFDAVIDLFYREGADAWFTREPSEYLPRGVKCETCGCTELTPEKDILDVWWESGVSHTSVLKH
1ffyA1          ----------------------------------------------------------------------
1ffyA2          ----------------------------------------------------------------------
1h78A           ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1ileA3          KEEAIGSFQE----LKARATKPLPEPFDPHRPYVDQVELACACGGTMRRVPYVIDVWYDSGAMPFASLHY
1h3nA3          --------GMVKVEEPFQGLFTQGMVLAWTDFGP----------------------------------VE
1ileA1          ----------------------------------------------------------------------
1f9dA           DVIKSGVKFIDIR-----------------------------SKYKQDPEWQTMVAALQAGQVPT-----
1j5qA1          LALPLIA------LQYHEVKLYFTLASQVQGV-----NYNGSSA-IAGAAQPTMSVWVDYIFLD------
1rqgA2          KVL-----------YVWFEAPIGYISITI------------EHFKRIGKPNEWKKYWLNIDGQTRVIHDN
1irxA2          ----------------------------------------------------------------------
1gaxA3          AVNVPRPERYLEDPTSCEACGSPRLKRDE----------------------DVFDTWFSSALWPLSTLGW
1a8hA2          RPWLQEYIQENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRVPLPWDENHVTYVWFDALLNYVSALDE
1iq0A2          ----------------------------------------------------------------------
1f4lA2          ------VWLDAPIG-------YMGSF---KNLCD----------KRGDSVSFDEYWKKDS----------
1euqA2          SVEENLALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYR-----IKFAEHHQTGNKWCIYPMYDF
1rqgA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
1x6mA           LDFVHTELSD--EDGWSAPEFAAFVSSII------------ESGVDPSRMEAIRARLRELGLEPYDALMD
1li5A2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1fl7B           ---FKELVYETVRVPGCAHHADSLYTYP-----------VATQCHCGKCDSDSTDCTVRGLGPSYCSFGE
1c4kA1          ----------------------------------------------------------------------
2d6yA2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1a14N           MTHTSQ----------------------------------------------------------------
1o5tA           ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1irxA2          --------------------------------------EIIEWDGGWKVKYKCPEGHEGWVDIRSGNVKL
1gaxA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          NGTATYYAKDIAFQFWKMGILEGLRFRPYENPYYPGLRTSAPEGEAYTPKAEETINVVD---------VR
1f4lA2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1li5A2          KGHAYVADNGDVMFDVPTDPTYGVLSRQKRNPMDFVLWKMSKEG-----EPSWPSPWGAGRPGWHIECSA


                         .         .         .         *         .         .         .:630
query           REAEGLRFPADMYLEGSDQHRGWFQSSLLTSMGAYGVPPYKAVMHCGFTVDGEGRKMSKSLGNGVDPAEV
1ffyA1          ----------------------------------------------------------------------
1ffyA2          ----------------------------------------------------------------------
1h78A           ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1ileA3          PEVFRESFPADFIAEGIDQTRGWFNSLHQLGVMLFGSIAFKNVICHGLILDEKGQKMSKSKGNVVDPWDI
1h3nA3          VEGSVVRLPEPTRIRLEIPESALSLEDVRKMG------AELRPHEDGTLHLWKPAVMSKSKGNGVMVGPF
1ileA1          ----------------------------------------------------------------------
1f9dA           ----------------QRLHRFWAQSEFAVANGVY-----------------------------------
1j5qA1          ----------------------------------------------------------------------
1rqgA2          IPFHAIFWPAFLMAYGKYKDEEVEAE-----------WNLPYDIPANEYLTLEGKKFSTSRNWAIWVHEF
1irxA2          ----------------------------------------------------------------------
1gaxA3          PEETEDLKPGDVLVTGYDILFLWVSRMEVSGYHFMGERPFKTVLLHGLVLDEKGQKMSKSKGNVIDPLEM
1a8hA2          GEAYRTFWPHAWHLIGKDILKPHAVFWPTMLK-AAGIPMYRHLNVGGFLLGPDGRKMSKTLGNVVDPFAL
1iq0A2          ----------------------------------------------------------------------
1f4lA2          -------TAELYHFIGKDIVYFHSLFWPAMLEGSNFRKPSN--LFVHGYVTVNGAKMSKSRGTFIKASTW
1euqA2          THCISDALEGITHSLCTLEFQDNRRLYDWVLDNITIPVHP--RQYEFSRLNLEYTVMSKRKLNLLVTDKH
1rqgA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
1x6mA           AIATHIAKRSGAL---------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
2bl7A1          ----------------------QIVHELYNDISI---SKDPKYSDILEVXQKVYLKLEKQKYE-LDPSPL
1d2rA           ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
2d6yA2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1bs2A2          -----------IYVIASQQD-LHAAQ-FFEILKQMGFEWAKDLQHVNFG---MVQGMSTRKGTVVFLDNI
1nzjA           ----------------------------------------------------------------------
1a14N           ----------------------------------------------------------------------
1o5tA           ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1irxA2          RWR--VDWPMRWSHFGVDFEPAGKDHLVAGSSYDTGKEIIKEVYGKEAPLSLMYEFVGIKGQNVILLSDL
1gaxA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          QSHPQALVRAALALAGYPALAEKAHHLAYETVLLEGRQMSGAVSVDEVLTRRARAIVEEKNPDHPDKEEA
1f4lA2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1li5A2          MNCKQLGNHFDIHGGGSDLMFPHHENEIAQSTCAHDGQYVNYWMHSGM-VMVDREKMSKSLGNFFTVRDV


                         .         +         .         .         .         .         *:700
query           MAKSGADVLRLWVASVDYSQDVSISDEILQRTSEAYRRIRNTFRFLLGSLDDFDDQKDAVSDWNALEPLD
1ffyA1          -----------------------------------YRKIRNTLRFMLGNINDFNPDTDSI-PESELLEVD
1ffyA2          ----------------------------------------------------------------------
1h78A           ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1ileA3          IRKFGADALRWYIYSAPPEADRRFGPNLVRETV-------------------------------------
1h3nA3          VKEQGADIARITILFAPPENEMVWTEEGV----QGAWR--------------------------------
1ileA1          ------------------------------------LTLWNVYSFFVTYANLDRPDLKNPPPPEKRPEMD
1f9dA           ----------------------------------------------------------------------
1j5qA1          ----------------------------------------------------------------------
1rqgA2          LDVFPADYLRYYLTTIPETRDSDFSFSDF-----------------------------------------
1irxA2          ----------------------------------------------------------------------
1gaxA3          VERYGADALRFALIYATGGQDIRLDLRWLEMAR-------------------------------------
1a8hA2          LEKYGRDALRYYLLREPYGQDTPVSEEALRTRYEA-----------------------------------
1iq0A2          ----------------------------------------------------------------------
1f4lA2          LNHFDADSLRYYYTAKLSSDDIDLNLEDFVQ---------------------------------------
1euqA2          VEGWDDPRMPTISGLRRR----GYTAASIREFCKRIGVTKQDNTIEMASLESC-----------------
1rqgA1          -----------------------------------GNFVHRALTFVNRYFDGVVPER------GELDELD
1gaxA5          --------------------------------------LYNAARFVLLSREGFQAKEDTPT------LAD
1gaxA2          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
1f4lA1          --------------------------------------ASRNAGFINKRFDGVLA----------SELAD
1x6mA           ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1h3nA1          ------------------------------------NRIYRRVAEDREALLETSGVFQAEA----LEGKD
2p84A1          ----------------------------------------------------------------------
2bl7A1          I-----NRLVNYLYFTAYTNKIRFT---------------------------------------------
1d2rA           ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
2d6yA2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1bs2A2          LEETKEKMHEV----MKKNENKYAQIEHPEEVADL-----------------------------------
1nzjA           ----------------------------------------------------------------------
1a14N           ----------------------------------------------------------------------
1o5tA           ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1irxA2          YEVLEPGLVRFIYARHRPNKEIKID---------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          ARMVALGAIRFSMVKTEPKKQIDFRYQEALS---------------------------------------
1f4lA2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1li5A2          LKYYDAETVRYFLMSGHYRSQLNYSEENLKQARAA-----------------------------------


                         .         .         .         .         +         .         .:770
query           QWAMVRTKHLLDDVSAAYDAYKFHYVYRAVYDYIVNDLSAVYMDATKDRLYSEAPDSPRRRAVQTVLMNI
1ffyA1          RYLLNRLREFTASTINNYENFDYLNIYQEVQNFINVELSNFYLDYGKDILYIEQRDSHIRRSMQTVLYQI
1ffyA2          ----------------------------------------------------------------------
1h78A           ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ileA1          RWLLARMQDLIQRVTEALEAYDPTTSARALRDFVVEDLSQWYVRRNRRRFWKNE-DALDREAAYATLYEA
1f9dA           ----------------------------------------------------------------------
1j5qA1          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1rqgA1          REALEEIEKAFKEVGELIMNYRFKDALKRVMSLA--SFGNRYFDHKQPWKTAKE-DKVRTGTTVNISLQI
1gaxA5          RFMRSRLSRGVEEITALYEALDLAQAAREVYELVWSEFCDWYLEAAKPALKAGNAHTLR------TLEEV
1gaxA2          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
1f4lA1          PQLYKTFTDAAEVIGEAWESREFGKAVREIMAL--ADLANRYVDEQAPWVVAKQEGRDDLQAICSMGINL
1x6mA           ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1a8hA1          ---------------PLVRELKFHVALEEAMAYV--KALNRYINEKKPWELFKK-EPEEARAVLYRVVEG
1h3nA1          RELYGKLHETLKKVTEDLEALRFNTAIAALME-----------------FLNALYEYRKDRPVTPVYRTA
2p84A1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
2d6yA2          ---------IEGWIDRLLDYHAAHPELLRLLFWEGXEYGTAELPHEAERQEHYARKVAAVRDGQE-----
1edzA2          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1a14N           ----------------------------------------------------------------------
1o5tA           ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LEVLVRVLAPVLSFTTDEVWEHYPQAMRERAGRPTNVQLAGWPKASDFAPAIPADGERVSEDFGVIMGVR
1ffyA1          LVDMTKLLAPILVHTAEEVWSHTPH------VKEESVHLADMPKVVEVDQALLDKWRT-------FMNLR
1ffyA2          ----------------------------------------------------------------------
1h78A           ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ileA1          LVLVATLAAPFTPFLAEVLWQNLV--RSVRLEAKESVHLADWPEA-DPAL----ADEALVAQMRAVLKVV
1f9dA           ----------------------------------------------------------------------
1j5qA1          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1rqgA1          VKALGILLEPFLPDASEKIWHLLNL------DEVKRWEFRELPAGHKVRKP-----EILFKKVTDDQIIY
1gaxA5          LAVLLKLLHPMMPFLTSELYQALT--------GKEELALEAWPEPGGRDEEAERAFEALKQ---AVTAVR
1gaxA2          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
1f4lA1          FRVLMTYLKPVLPKLTERAEAFL--------NTELTWDGIQQPLLG---HKVNP--FKALYNRIDMRQVE
1x6mA           ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1a8hA1          LRIASILLTPAMPDKMAELRRALGL-----KEEVRLEEAERWGL---------AEPRPIPEEAPVLF---
1h3nA1          IRYYLQMLFPFAPHLAEELWHWFW---------PDSLFEAGWPEL-------------------------
2p84A1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
2d6yA2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1a14N           ----------------------------------------------------------------------
1o5tA           ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           EVVTKALEDARGQKVVNKSQEAAVVVTAPRAVLDAVERYDAAVFEELFIVASVSFAEGEELAATVSKTEA
1ffyA1          DDVNRALETARNEKVIGKSLEAKVTIASNDKFNASEFLTSFDALHQLFIVSQVKVVDKEHGDIVIEHADG
1ffyA2          ----------------------------------------------------------------------
1h78A           ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ileA1          DLARAARAKSG-----------------------------------------------------------
1f9dA           ----------------------------------------------------------------------
1j5qA1          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1rqgA1          FILNYMAKGNPEGARILLDKYYKREDVIRVAKEKFGDEAEVVL-RRVYKD--------------------
1gaxA5          AL--------KAEAGLPPAQEVRVYLEGETAPVEE----NLEVFR--FLSRADLLPERPAKALVKAMPRV
1gaxA2          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
1f4lA1          ALVEASKE--------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
2d6yA2          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1a14N           ----------------------------------------------------------------------
1o5tA           ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           EKCPRCWNHRALGGNANHGSVCERCGDALDAIxxxxxx
1ffyA1          EKCERCWNYSELGAVDELTHLCPRCQQVVKSL------
1ffyA2          --------------------------------------
1h78A           --------------------------------------
1ffyA3          --------------------------------------
1n1bA2          --------------------------------------
1h3nA2          --------------------------------------
1ileA2          --------------------------------------
1ileA3          --------------------------------------
1h3nA3          --------------------------------------
1ileA1          --------------------------------------
1f9dA           --------------------------------------
1j5qA1          --------------------------------------
1rqgA2          --------------------------------------
1irxA2          --------------------------------------
1gaxA3          --------------------------------------
1a8hA2          --------------------------------------
1iq0A2          --------------------------------------
1f4lA2          --------------------------------------
1euqA2          --------------------------------------
1rqgA1          --------------------------------------
1gaxA5          T-------------------------------------
1gaxA2          --------------------------------------
1a1xA           --------------------------------------
1pzdA1          --------------------------------------
1f4lA1          --------------------------------------
1x6mA           --------------------------------------
1li5A2          --------------------------------------
1j1uA           --------------------------------------
1qmyA           --------------------------------------
1jfaA           --------------------------------------
1a8hA1          --------------------------------------
1h3nA1          --------------------------------------
2p84A1          --------------------------------------
2bl7A1          --------------------------------------
1d2rA           --------------------------------------
1fl7B           --------------------------------------
1c4kA1          --------------------------------------
2d6yA2          --------------------------------------
1edzA2          --------------------------------------
1bs2A2          --------------------------------------
1nzjA           --------------------------------------
1a14N           --------------------------------------
1o5tA           --------------------------------------
1ileA3          --------------------------------------
1rqgA2          --------------------------------------
1irxA2          --------------------------------------
1gaxA3          --------------------------------------
1a8hA2          --------------------------------------
1iq0A2          --------------------------------------
1f4lA2          --------------------------------------
1euqA2          --------------------------------------
1li5A2          --------------------------------------