[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV55587.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1g18A1.bssp"
#ERROR : Can't open dsspfile "1oftA.bssp"
#ERROR : Can't open dsspfile "1n0wA.bssp"
#ERROR : Can't open dsspfile "1g18A2.bssp"
#ERROR : Can't open dsspfile "1tf7A1.bssp"
#ERROR : Can't open dsspfile "1tf7A2.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"

## Summary of PDB Search
:352
    1e-29  54%  1g18A1 [c.37.1.11] RECA PROTEIN A:3 -- 269
    4e-23  18%  1oftA  [c.37.1.22] HYPOTHETICAL PROTEIN PA3008
    4e-14  30%  1n0wA  [c.37.1.11] DNA REPAIR PROTEIN RAD51 HOMOLOG 1
    2e-13  53%  1g18A2 [d.48.1.1] RECA PROTEIN A:270 -- 329
    3e-12  16%  1tf7A1 [c.37.1.11] KAIC A:14 -- 255
    8e-07  26%  1tf7A2 [c.37.1.11] KAIC A:256 -- 497
    4e-06  18%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    7e-05  22%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    1e-04  11%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    1e-04  12%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    2e-04  26%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    3e-04  21%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE
    4e-04  24%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    5e-04  22%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    7e-04  26%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    9e-04  11%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
:352

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESS
1g18A1          -TPDREKALELAVAQIEKSYGKGSVMRLGDEARQP-ISVIPTGSIALDVALGIGGLPRGRVIEIYGPESS
1oftA           --------------------------------------------------------PAAFSELSLSGLPG
1n0wA           --------------------------------------QITTGSKELDKLLQ-GGIETGSITEXFGEFRT
1g18A2          ----------------------------------------------------------------------
1tf7A1          ---------------------------------------MRTMIEGFDDISH-GGLPIGRSTLVSGTSGT
1tf7A2          ---------------------------------------VSSGVVRLDEMCG-GGFFKDSIILATGATGT
1e2hA           --------------------------------------------------------PTLLRVYIDGPHGM
1cr0A           -----------------------------------SVGLLFSGCTGINDKTL--GARGGEVIMVTSGSGM
2v3jA1          -------------------------------------------------------DKITKRXIVVLAXAS
1tueA           ------------------------------------------------------GTPKKNCLVFCGPANT
1lw7A2          -------------------------------------------------------PFFAKTVAILGGESS
1p5zB           ---------------------------------------------------------RIKKISIEGNIAA
1zp6A1          ---------------------------------------------------------GGNILLLSGHPGS
1e3mA2          ------------------------------------------------------LSPQRRXLIITGPNXG
1ffhA2          ----------------------------------------------------LPVLKDRNLWFLVGLQGS
1grqA           ---------------------------------------------------------TTRMIILNGGSSA


                         .         .         *         .         .         .         .:140
query           GKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGXXXX
1g18A1          GKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDI
1oftA           HCLTLLAPILRELSEDARWLTLIAPPASLTHEWLRRAGLNRERILLLQAKDNAAALALSCEALRLG----
1n0wA           GKTQICHTLAVTCQLGEGKAXYIDTEGTFRPEVAERYGLSGSDVLDFNTDHQTQLLYQASAXXVES----
1g18A2          ----------------------------------------------------------------------
1tf7A1          GKTLFSIQFLYNGIIFDEPGVFVTFEETPQDINARSFGWDLAKLVVVGGFDLSALIERINYAIQKYRARR
1tf7A2          GKTLLVSRFVENACANKERAILFAYEESRAQLLAYSWGMDFEE---------------------------
1e2hA           GKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIY----------------------------------
1cr0A           GKSTFVRQQALWGTAMGKKVGLAMLEESVEET--------------------------------------
2v3jA1          LETHKIYVLLNCDDHQGLLK--------------------------------------------------
1tueA           GKSYFG-MSFIHFIQGAVISFVNSTSHFWLEPLTDTKVAMLDDATTTCWTYFDTYMR-------------
1lw7A2          GKSVLVNKLAAVFNTTSAWE--------------------------------------------------
1p5zB           GKSTFV-NILKQLCEDWEVVPEPVARW-------------------------------------------
1zp6A1          GKSTIAEALANLPGVPKVHFHSDD----------------------------------------------
1e3mA2          GKSTYXRQTALIALXAYIGSYVPA----------------------------------------------
1ffhA2          GKTTT-----------------------------------------------------------------
1grqA           GKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIG-------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKIGVMFGNPETTT
1g18A1          VVIDSVAALVPRAELEGEMHV---GLQARLMSQALRKMTGALNNSGTTAIFINQ--------------LT
1oftA           ------------------RSHTVVSWLEPLSRAARKQLSRAAQLGQAQSLNI------------------
1n0wA           ----------------------------------------------------------------------
1g18A2          ----------------------------------------------------------------------
1tf7A1          VSIDSVTSVFQQYDASSV------------VRRELFRLVARLKQIGATTVMTTERIEEYGPIAR------
1tf7A2          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GGRALKFFXXXXXXXXXXXXXXXXGEIVGXXXXXXXXXXXXXXXFRQAEFDLMYGEGISREGCIVDMAVE
1g18A1          GGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGI------------
1oftA           ----------------------------------------------------------------------
1n0wA           ----------------------------------------------------------------------
1g18A2          ----------------------------------------------------------SREGSLIDMGVD
1tf7A1          ----------------------------------------------------------------------
1tf7A2          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDLREELETKVRExxxxxxxxxxxxxxxxxxxxxxxxx
1g18A1          ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1n0wA           ----------------------------------------------------------------------
1g18A2          QGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKE-------------------------
1tf7A1          ----------------------------------------------------------------------
1tf7A2          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xx
1g18A1          --
1oftA           --
1n0wA           --
1g18A2          --
1tf7A1          --
1tf7A2          --
1e2hA           --
1cr0A           --
2v3jA1          --
1tueA           --
1lw7A2          --
1p5zB           --
1zp6A1          --
1e3mA2          --
1ffhA2          --
1grqA           --