[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV55743.1

[Show Plain Result]

#ERROR : Can't open dsspfile "13pkA.bssp"
#ERROR : Can't open dsspfile "1k8tA.bssp"
#ERROR : Can't open dsspfile "1zczA2.bssp"
#ERROR : Can't open dsspfile "1puzA.bssp"
#ERROR : Can't open dsspfile "1ymyA2.bssp"
#ERROR : Can't open dsspfile "1ywuA1.bssp"
#ERROR : Can't open dsspfile "1v8hA1.bssp"
#ERROR : Can't open dsspfile "1xa3A.bssp"

## Summary of PDB Search
:394
    e-139  46%  13pkA  [c.86.1.1] 3-PHOSPHOGLYCERATE KINASE
    5e-66  10%  1k8tA  [e.41.1.1] CALMODULIN-SENSITIVE ADENYLATE CYCLASE
    1e-42  18%  1zczA2 [c.97.1.4] BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH
    2e-14  19%  1puzA  [a.218.1.1] CONSERVED HYPOTHETICAL PROTEIN
    1e-10  10%  1ymyA2 [c.1.9.10] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:54
    6e-10  14%  1ywuA1 [b.45.2.1] HYPOTHETICAL PROTEIN PA4608 A:1 -- 125
    5e-09  14%  1v8hA1 [b.1.18.19] SULFUR OXIDATION PROTEIN SOXZ A:2 -- 107
    3e-05  14%  1xa3A  [c.123.1.1] CROTONOBETAINYL-COA:CARNITINE COA-TRANSFERASE
:394

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxKTIDELDARGKRVLVRVDFNVPVKDGAVTDDTRIRAALPTIQKLVDDGARVILMSHLGRPAGEGFE
13pkA           ----KSINECDLKGKKVLIRVDFNVPVKNGKITNDYRIRSALPTLKKVLTEGGSCVLMSHLGRPKGIGFQ
1k8tA           ----------VLKGEKALKASGLVPEHADAFIARELNFRPVNKLATNLIKSGVATKGLNVHGKSSDWPFD
1zczA2          ----------------------------------------------------------------------
1puzA           ----------------------------------------------------------------------
1ymyA2          -----------EIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQALGLHLEGPWLN-LV
1ywuA1          ----------QHDERRRFHRIAFDADSE---ILQGERRWEV--LLHDVSLHGILVGQPQDWNGDPQRPFE
1v8hA1          ----------------------------------------------------------------------
1xa3A           -------------------------------VVFSGIEIAGPFAGQXFAEWGAEVIWIENVAWADTIRVQ


                         .         .         *         .         .         .         .:140
query           ESFTLRPAAQKLSELMGKPVVFATDTVGDDARAKAASLRDGDVLVVENLRFDKREKKNDPAFCEELAALG
13pkA           QKATLKPVAKRLSELLLRPVTFAPDCLN--AADVVSKMSPGDVVLLENVRFYKEEAKDREAMAKILASYG
1k8tA           QDLSKKHGQQLAVEKGNLENKKSITEHEGEIGKIPLKLDHLRIELKENGIILKGKKEIDYYLLESNNQVY
1zczA2          -----------------------------------------------SLAFKR--EDLQLRYGENPHEKA
1puzA           ----------------------------------------------------------------------
1ymyA2          PNFVRKPDAALVDFLCENADVITKVTLAPEMVPAEV----ISKLANAGIVVSAGHSNATLKEAKAGFRAG
1ywuA1          --ARLYLGLDVLIRMEISLAWARDGLLG------------------------------------------
1v8hA1          ---------------------------RTIARLNPAKPKAGEEFRLQVVAQHPAKYINLVEVYFEGEKVA
1xa3A           PNYPQLSRRNLHA--------LSLNIFKDEGREAFLKLXETTDIFIEASKGPAFARRGITD--EVLWQHK


                         +         .         .         .         .         *         .:210
query           EAYVNDAFGTAHRAHASTAGVAALLPAYAGYLMQREVATLSGMLEEPRRPFTAILGGSKVSDKIKVIDAL
13pkA           DVYISDAFGTAHRDSATMTGIPKILGGAAGYLMEKEISYFAKVLGNPPRPLVAIVGGAKVSDKIQLLDNM
1k8tA           EFRISDENNEVQTKEGKITVLGEKFNWRNIEVMAKNVEGVIKKQIPQKEWDKVVNTPNSLEKQKGVTN--
1zczA2          FVYGKPAFEILHEGKTI--SFNNILDAENAWFMAKNLPRMGAVVVKHQSPCGAAIG----EDKVEIVKKA
1puzA           ----------TRRGLLELDLIFGFMEKEFEHLSDKELSEFSEILEFQDQELLALINGHSETDKGHLI-PM
1ymyA2          ITFATHLYNAMPYITGREPGLAG--AILDEADIYCGIIADGLHVDYANIRNAKRLKGDKLC---------
1ywuA1          ----------------------------------------------------------------------
1v8hA1          EARPGPSTSANPLYAFKFKAEKA-----------------------------------------------
1xa3A           LVIAHSGFGYGTEEYTNLPAYNTIAQAFSG------YLIQNGDVDQPXPAFPYT----------------


                         .         .         .         +         .         .         .:280
query           MDKCDTLIIGGGMCFTFLLAQGKAVGTSLKEEDWVERAAAMIAKAEERGVQLLLPVDVVCADRFAEDAET
13pkA           LQRIDYLLIGGAMAYTFLKAQGYSIGKSKCEESKLEFARSLLKKAEDRKVQVILPIDHVCHTEFKAVDSP
1k8tA           LLIKYGIERKPDSTKGTLSNWQKQMLDRLNEAVKYTGYTGGDVVNHGT----------------------
1zczA2          IEADDESSFGGILAVNF--EMDEEVAKSLKKYLEVIVAPSFTQEAIEKKVRLLKPGDYASWA-GKMAFGS
1puzA           LEKIR-----------------------------------------------------------------
1ymyA2          ----------------------------------------------------------------------
1ywuA1          ----------------------------------------------------------------------
1v8hA1          ----------------------------------------------------------------------
1xa3A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LTVSVDGIPGDMMGLDIGPETAKLYADAVAQAKTVFWNGPMGVFEMKAFXXXXXXXXXXXXXXXXXXXII
13pkA           LITEDQNIPEGHMALDIGPKTIEKYVQTIGKCKSAIWNGPMGVFEMVPYTFAIAKAMGRGTHEHGLMSII
1k8tA           -NEIFIINPEGEFILTKNWEMTGRFIEKNITGKDYLYYFNRSYNKIAPG-NKAYIEWTDPITKAKINTIP
1zczA2          LVLSERKYPEG----NFELVVGEPLSEKELEDLEFAYRVVEGAKSN-----------AVLIAKDGVTVGI
1puzA           ----------------------------------------------------------------------
1ymyA2          ----------------------------------------------------------------------
1ywuA1          ----------------------------------------------------------------------
1v8hA1          ----------------------------------------------------------------------
1xa3A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GGGDSVAAVNKFDLAEQMTFISTGGGASMELVQGEALPGVEALK
13pkA           GGGDSASAAELSGEAKRMSHVSTGGGASLELLEGKTLPGVTVLD
1k8tA           TSAEFIKNLSSIRRSSNVGVYKDSGDKD-EFAKKESVKKIAGY-
1zczA2          GSGQPSRKRAAWIATVMAGEKSDAFFPFPDSLEILAQAGVKA--
1puzA           --------------------------------------------
1ymyA2          --------------------------------------------
1ywuA1          --------------------------------------------
1v8hA1          --------------------------------------------
1xa3A           --------------------------------------------