[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV55893.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1omsA.bssp"
#ERROR : Can't open dsspfile "1w26A1.bssp"
#ERROR : Can't open dsspfile "1t11A1.bssp"
#ERROR : Can't open dsspfile "1jvwA.bssp"
#ERROR : Can't open dsspfile "1fd9A.bssp"
#ERROR : Can't open dsspfile "1hxvA.bssp"
#ERROR : Can't open dsspfile "1a7xA.bssp"
#ERROR : Can't open dsspfile "1q6hA.bssp"

## Summary of PDB Search
:501
    3e-22  29%  1omsA  [d.241.2.1] TRIGGER FACTOR
    4e-11  18%  1w26A1 [a.223.1.1] TRIGGER FACTOR A:248 -- 432
    1e-07  18%  1t11A1 [a.223.1.1] TRIGGER FACTOR A:248 -- 376
    5e-07  11%  1jvwA  [d.26.1.1] MACROPHAGE INFECTIVITY POTENTIATOR
    2e-06   9%  1fd9A  [d.26.1.1] PROTEIN (MACROPHAGE INFECTIVITY POTENTIATOR
    1e-05  23%  1hxvA  [d.26.1.1] TRIGGER FACTOR
    6e-05  18%  1a7xA  [d.26.1.1] FKBP12
    2e-04  18%  1q6hA  [d.26.1.1] FKBP-TYPE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
:501

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxETKVEALEDNRTKVTVTVDAADIDARIKKTYKDFANKYNFPGFRKGKAPRPIIDNALGAEAVR
1omsA           -------QVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPXNIVAQRYG-ASVR
1w26A1          ----------------------------------------------------------------------
1t11A1          ----------------------------------------------------------------------
1jvwA           ----------------------------------------------------------------------
1fd9A           ------------------------------------------------------------------IDVN
1hxvA           ----------------------------------------------------------------------
1a7xA           ----------------------------------------------------------------------
1q6hA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ATVTDDVVNGTYPLAIDDCDLYPIAKPEFDETDLVEAGKPYTFSFTVTVKPEIEISSYEPVEIELPAEGT
1omsA           QDVLGDLXSRNFIDAIIKEKINPAGAPTYVPGEY-KLGEDFTYSVEFEVYPEV-----------------
1w26A1          ----------------------------------------------------------------------
1t11A1          ----------------------------------------------------------------------
1jvwA           --------------------------------------------------HEERMNNYRKRVGRLMEQKA
1fd9A           PEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQ--------KDLMAKRTAEFNKKADENKVKGEAFLTENK
1hxvA           ----------------------------------------------------------------------
1a7xA           ----------------------------------------------------------------------
1q6hA           ---------------------------------------------------------------EYREKFA


                         +         .         .         .         .         *         .:210
query           TDAEIDEQIDALREHYYSFEDASAATKVKEDSYIDLAMKATDDKGEEIPSLTTENRPYGLGANLFPAEFD
1omsA           ----------------------------------------------------------------------
1w26A1          ----------------------------------------------------------------------
1t11A1          ----------------------------------------------------------------------
1jvwA           AQPDAVKLPSGLVFQRIARGSG--KRAPAIDDKCEVHYTGRLRDGTVFDSSRERGKPTTFRPNEVIKGWT
1fd9A           NKPGVVVLPSGLQ---YKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWT
1hxvA           --------------------------KLANGDIAIIDFTGIVD-NKKLASASAQNYELTIGSNSFIKGFE
1a7xA           --------------------------FPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKLGKQEVIRGWE
1q6hA           KEKGVKTSSTGLV---YQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWT


                         .         .         .         +         .         .         .:280
query           EQLVGLKKGQTATFTLDMPADxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDEWAKEQMGFESVEDL
1omsA           ----------------------------------------------------------------------
1w26A1          ------------------------------------------------------AEFIKRGVEDGSVEGL
1t11A1          ------------------------------------------------------DEFVARGVAEGGVDAL
1jvwA           EALQLMREGDRWRLFIPYDLA-------------------------------------------------
1fd9A           EALQLMPAGSTWEIYV------------------------------------------------------
1hxvA           TGLIAMKVNQKKTLALTFPSD-------------------------------------------------
1a7xA           EGVAQMSVGQRAKLTISPDYA-------------------------------------------------
1q6hA           EGLKNIKKGGKIKLVIP-----------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RARIAESVTSQKADMMPRLKENACLYALAERVEGDVPEAMLEDAEASLIQDFFQQLQSQGMTFDVYLAQQ
1omsA           ----------------------------------------------------------------------
1w26A1          RAEVRKNXERELKSAIRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRFGGNEKQ--------
1t11A1          KAEVRKNMERELKQAIKARIKEQAIEGLVKENEIQVPSALIDQEINVLRQQAAQRFGGNVEA--------
1jvwA           ----------------------------------------------------------------------
1fd9A           ----------------------------------------------------------------------
1hxvA           ----------------------------------------------------------------------
1a7xA           ----------------------------------------------------------------------
1q6hA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GITPDQFKEDVKKQAEDMSKQDLALDAWARHFGMXXXXXXXXXXXXKSGVEDPAALEAEWRSNGQLHMVR
1omsA           ----------------------------------------------------------------------
1w26A1          --ALELPRELFEEQAKRRVVVGLLLGEVIRTNELKADEERVKGLIEEXASAPKEVIEFYSKNKELXDNXR
1t11A1          --AAQLPRELFEEQAKRRVVVGLLLGEVIR----------------------------------------
1jvwA           ----------------------------------------------------------------------
1fd9A           ----------------------------------------------------------------------
1hxvA           ----------------------------------------------------------------------
1a7xA           ----------------------------------------------------------------------
1q6hA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           QGVIRTKAVKDIMDKAVVTELDLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1omsA           ----------------------------------------------------------------------
1w26A1          NVALEEQAVEAVLAKAKVTEKETT----------------------------------------------
1t11A1          ----------------------------------------------------------------------
1jvwA           ----------------------------------------------------------------------
1fd9A           ----------------------------------------------------------------------
1hxvA           ----------------------------------------------------------------------
1a7xA           ----------------------------------------------------------------------
1q6hA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxx
1omsA           -----------
1w26A1          -----------
1t11A1          -----------
1jvwA           -----------
1fd9A           -----------
1hxvA           -----------
1a7xA           -----------
1q6hA           -----------