[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV55965.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bazA.bssp"
#ERROR : Can't open dsspfile "1b01A.bssp"
#ERROR : Can't open dsspfile "2ay0A1.bssp"
#ERROR : Can't open dsspfile "1mntA.bssp"

## Summary of PDB Search
:85
    2e-05  22%  1bazA  [a.43.1.1] ARC REPRESSOR
    4e-05  24%  1b01A  [a.43.1.3] TRANSCRIPTIONAL REPRESSOR COPG
    8e-04  19%  2ay0A1 [a.43.1.11] BIFUNCTIONAL PUTA PROTEIN A:3 -- 45
    0.001  16%  1mntA  [a.43.1.1] MNT REPRESSOR
:85

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTETKRVNVDMPIWMVEALDKEAKRVGIGRQAVIK
1bazA           ------------------------------------SKMPQVNLRWPREVLDLVRKVAEENGRSVNSEIY
1b01A           --------------------------------------KKRLTITLSESVLENLEKMAREMGLSKSAMIS
2ay0A1          --------------------------------------TTTMGVMLDDATRERIKSAATRIDRTPHWLIK
1mntA           ------------------------------------RDDPHFNFRMPMEVREKLKFRAEANGRSMNSELL


                         .         .         *         .         .         .         .:140
query           MWLAERLDEEARRSA
1bazA           QRVMESFKKEGRIGA
1b01A           VALENYKKGQ-----
2ay0A1          QAIFSYLEQL-----
1mntA           QIVQDALSKPSPVTG