[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV55970.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2id1A1.bssp"
#ERROR : Can't open dsspfile "2o5aA1.bssp"

## Summary of PDB Search
:142
    3e-31  32%  2id1A1 [d.218.1.12] HYPOTHETICAL PROTEIN A:1 -- 120
    2e-23  31%  2o5aA1 [d.218.1.12] BH1328 PROTEIN A:2 -- 114
:142

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxTSRECALIAACAADEKKATDIMVQEVRDLIGVTDYFVIATASNNRQVEAIIDEIEDAVRTKA
2id1A1          ----------QEISKLAIEALEDIKGKDIIELDTSKLTSLFQRXIVATGDSNRQVKALANSVQVKLK-EA
2o5aA1          --------SNQELLQLAVNAVDDKKAEQVVALNXKGIS--LDFFLICHGNSEKQVQAIAHELKKVAQ-EQ


                         .         .         *         .         .         .         .:140
query           QMKPLHREGTQDGTWSLLDYGSFVVHVFQPETREYYRLEALWNDAPVxxxxxxxxxxxxxxxxxxxxxxx
2id1A1          GVDIVGSEGHESGEWVLVDAGDVVVHVXLPAVRDYYDIEALWGGQKP-----------------------
2o5aA1          GIEIKRLEGYEQARWVLIDLGDVVVHVFHKDERAYYNLEKLWPTVEL-----------------------


                         +         .         .         .         .         *         .:210
query           xx
2id1A1          --
2o5aA1          --