[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV56026.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1c3qA1.bssp"

## Summary of PDB Search
:278
    1e-24  32%  1c3qA1 [c.72.1.2] PROTEIN (HYDROXYETHYLTHIAZOLE KINASE) A:1 -- 272
:278

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxALDNVRATTPLVHNITNYVTVNDCANALLAIGASPIMSDEPADVFDITSICGGLTLNIGTLN
1c3qA1          --------CLTAVRRHSPLVHSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAGALVLNIGTLS


                         .         .         *         .         .         .         .:140
query           ERSIQGMFAAGERASELGHPIVLDPVGAGASALRTRTASDLLDKLAVSVVRGNMSEXXXXXXXXXXTRGV
1c3qA1          KESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAE------IAHTVGVT


                         +         .         .         .         .         *         .:210
query           DVCPGDAVTEDNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXERAYAVRNGSPLMGRITGAGCMLSCVC
1c3qA1          DWLIKGVDAGEGGGDIIRLAQQAAQKLNTVIAITGEVDVIADTSHVYTLHNGHKLLTKVTGAGCLLTSVV


                         .         .         .         +         .         .         .:280
query           AAFATANPXXXXXXXXXXXXGMGLAGQIAQGRMGGYDGNGSFRTYLLDALYNLDGDALEAGARVEELx
1c3qA1          GAFCAVEENPLFAAIAAISSY-GVAAQLA-AQQTADKGPGSFQIELLNKLSTVTEQDVQEWATIERV-