[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV56092.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1hc8A.bssp"
#ERROR : Can't open dsspfile "3cjqB1.bssp"
#ERROR : Can't open dsspfile "1mmsA2.bssp"
#ERROR : Can't open dsspfile "1wibA.bssp"

## Summary of PDB Search
:166
    3e-22  62%  1hc8A  [a.4.7.1] RIBOSOMAL PROTEIN L11
    1e-13  52%  3cjqB1 [a.4.7.1] 50S RIBOSOMAL PROTEIN L11 B:71 -- 137
    2e-11  70%  1mmsA2 [d.47.1.1] PROTEIN (RIBOSOMAL PROTEIN L11) A:8 -- 70
    7e-10  10%  1wibA  [d.47.1.1] 60S RIBOSOMAL PROTEIN L12
:166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xAEKKQTGFIKLQIXXXXXXXXXXXXXXXXXXXVNIMQFCQAFNAQTQDQSGTIIPVEITVYEDKSFTFV
1hc8A           -------------------------------------------------------------------TFI
3cjqB1          ----------------------------------------------------------------------
1mmsA2          ---------------------------------VNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFI
1wibA           -FDPNEVKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQ-NRQAQI-


                         .         .         *         .         .         .         .:140
query           CKTPPAAVLIKEKLNINSGSGLPHVQPVGTLTEDQLREIAEIKMPDLNANTIEAAMEIIAGTARSMGVRI
1hc8A           TKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVV
3cjqB1          ----------------------PPASYLIRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGV--
1mmsA2          ----------------------------------------------------------------------
1wibA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           Exxxxxxxxxxxxxxxxxxxxxxxxx
1hc8A           E-------------------------
3cjqB1          --------------------------
1mmsA2          --------------------------
1wibA           --------------------------