[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV56128.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1fjgN.bssp"
#ERROR : Can't open dsspfile "1vs5N1.bssp"

## Summary of PDB Search
:61
    6e-22  67%  1fjgN  [g.39.1.7] 30S RIBOSOMAL PROTEIN S14
    2e-14  47%  1vs5N1 [g.39.1.7] 30S RIBOSOMAL PROTEIN S14 N:1 -- 100
:61

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xAKKSMVAKAKREPKFSTRQHNRCTRCGRPRAYYRKFGLCRVCLRELANKGELPGVTKASW
1fjgN           -ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
1vs5N1          --------QTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW