[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV56185.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1o4uA1.bssp"
#ERROR : Can't open dsspfile "1ytdA2.bssp"
#ERROR : Can't open dsspfile "1o4uA2.bssp"
#ERROR : Can't open dsspfile "1qapA2.bssp"
#ERROR : Can't open dsspfile "1x7fA2.bssp"
#ERROR : Can't open dsspfile "1ytdA1.bssp"
#ERROR : Can't open dsspfile "1p0kA.bssp"
#ERROR : Can't open dsspfile "1qpnA2.bssp"
#ERROR : Can't open dsspfile "1euaA.bssp"
#ERROR : Can't open dsspfile "2a4aA1.bssp"
#ERROR : Can't open dsspfile "1efzA.bssp"

## Summary of PDB Search
:280
    1e-21  28%  1o4uA1 [c.1.17.1] TYPE II QUINOLIC ACID PHOSPHORIBOSYLTRANSFERASE
    2e-16  20%  1ytdA2 [d.41.2.1] NICOTINATE PHOSPHORIBOSYLTRANSFERASE FROM A:1 --
    2e-14  23%  1o4uA2 [d.41.2.1] TYPE II QUINOLIC ACID PHOSPHORIBOSYLTRANSFERASE
    9e-14  22%  1qapA2 [d.41.2.1] QUINOLINIC ACID PHOSPHORIBOSYLTRANSFERASE A:8 --
    4e-07  24%  1x7fA2 [c.1.8.12] OUTER SURFACE PROTEIN A:1 -- 244
    1e-05  21%  1ytdA1 [c.1.17.1] NICOTINATE PHOSPHORIBOSYLTRANSFERASE FROM A:120
    3e-05  21%  1p0kA  [c.1.4.1] ISOPENTENYL-DIPHOSPHATE DELTA-ISOMERASE
    3e-04  27%  1qpnA2 [d.41.2.1] PROTEIN (QUINOLINATE PHOSPHORIBOSYL TRANSFERASE)
    3e-04  15%  1euaA  [c.1.10.1] KDPG ALDOLASE
    5e-04   9%  2a4aA1 [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE A:3 -- 258
    6e-04  21%  1efzA  [c.1.20.1] TRNA-GUANINE TRANSGLYCOSYLASE
:280

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxISDTRIDGFIAEDVPYVDLTCAVLGIGDEPGEMEYFTREDCVLAGANVVARIMGKLGCDVVEARRDG
1o4uA1          ----------------------------------------------------------------------
1ytdA2          ---ASDEDIKKGLASDVYFERTISAIGDKCDLRVAMEATLDTWINFTGLDEVLKLLEGLDVDLYAILFPR
1o4uA2          --------LMSFVKEDEGKLDLASFPLRNTTAGA-HLLLKTENVVASGIEVSRMFLEKMGLLSKFNVEDG
1qapA2          -----PAAVAQALREDLGAGNDITAQLLPADTQAHATVITREDGVFCGKRWVEEVFAGDDVRLTWHVDDG
1x7fA2          ----------------------------------------------------------------------
1ytdA1          ----------------------------------------------------------------------
1p0kA           ----------------------------------------------------------------------
1qpnA2          ------------LDEDLRYPDVTTLATVPASATTTASLVTREAGVVAGALLTLNEVLGTNGYRVLRVEDG
1euaA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1efzA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ERATAGEAFFRVRGTAGDLHAAWKVCLNVFDHMSAVATKTRAMVDAAHAENPRCEVLTTRKSMPGAKDLL
1o4uA1          -----------------------------------VATTTRRFAEKLKH----AKIAATRKILPGLGVLQ
1ytdA2          DANGLPVPFIRVEGRYCDFGMYETAILGFICQASGI----------------------------------
1o4uA2          EYLEGTGVIGEIEGNTYKLLVAERTLLNVLSVMFS-----------------------------------
1qapA2          DAIHANQTVFELQGPARVLLTGERTALNFVQTLSG-----------------------------------
1x7fA2          ----------------------------------------------------------------------
1ytdA1          ------------------------------------STKASKVRLAA--GDSPFFSFGIRRMHPAISPMI
1p0kA           ----------------------------------------------------------------------
1qpnA2          ARVPPGEALMTLEAQTRGLLTAERTMLNLVGHLS------------------------------------
1euaA           ----------------------------------------------------------------------
2a4aA1          ------------------------------------------------------------TDSMEKVLND
1efzA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TEAVMAGGAFPHRLGLSETVLVFDHHLTFFGGFEAFVEQLPDIKGRCVEKKLFVEADAERARVLARAGVD
1o4uA1          KIAVVHGGG--------DCVMIKDNHLKMYGSAERAVQEVRKIIP--FTTKIEVEVNLEDALRAVEAGAD
1ytdA2          ----------------------------------------------------------------------
1o4uA2          ----------------------------------------------------------------------
1qapA2          ----------------------------------------------------------------------
1x7fA2          ----------------------------------------------------TKEKDMAYISAAARHGFS
1ytdA1          DRSAYIGGADGVS-GILGAKLIDQHALSIMLGWKLTLENTKNGQKSVIDTYMDEKFAAIKAEMFDK--VD
1p0kA           ------------------------------------------VSVPVIVKEVGFGMSKASAGKLYEAGAA
1qpnA2          ----------------------------------------------------------------------
1euaA           ----------------------------------------------------------------MDYGLK
2a4aA1          TEKALDDGADEIDLVINYKKIIENTDEGLKEATKLTQSVKKLLTNKILKVIITEDLIIKTTLAVLNGNAD
1efzA           -----------------------------------------------QQGSVFENLRQQSADALAEIGFD


                         .         .         .         +         .         .         .:280
query           GIQVDKVPVDELEPLVRELRAIDPHVTLIAAGGVNPQNAGAYAATGVDGLATTAPFSAKPLDMSVRMRxx
1o4uA1          IVMLDNLSPEEVKDISRRIKDINPNVIVEVSGGITEENVSLYDFETVDVISSSRLLQEVFVDLSLEIQ--
1ytdA2          ----------------------------------------------------------------------
1o4uA2          ----------------------------------------------------------------------
1qapA2          ----------------------------------------------------------------------
1x7fA2          RIFTCLLSVAEFKEIINHAKDNNMEVILDVAPAVFYSDLSFFAELGADGI--------------------
1ytdA1          YIRLDTPSSRRFEALIREVRWERSDIKIMVSGGLDENTVKKLREAGAEAFVGTSISSAKPFDFAMDI---
1p0kA           AVDIGGRQISFFNSWLAEIRSEFPASTMIASGGL------------------------------------
1qpnA2          ----------------------------------------------------------------------
1euaA           EFKFFPAEANGGVKALQAIAGPFSQVRFCPTGGISPANYRDYLALKSVL---------------------
2a4aA1          TPSSVEYIIKAIKEYIKNNPEKNNKIGLKVSGGISLNTASHYILLARRFLSDNFRIGSSSL---------
1efzA           GYAVGGLAVDEMFRVLDFSVPMLPDKPHYLMGVGKPDDIVGAVERGIDMFCVLPTRSG------------