[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV56217.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1oxwA.bssp"
#ERROR : Can't open dsspfile "1cjyA2.bssp"

## Summary of PDB Search
:295
    4e-16  14%  1oxwA  [c.19.1.3] PATATIN
    2e-07   9%  1cjyA2 [c.19.1.2] PROTEIN (CYTOSOLIC PHOSPHOLIPASE A2) A:142 -- 721
:295

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxVHDVALVFEGGGMRNSYSAGAIGVMLEQGLFFDDVYGLSAGATNAIDYVSRDARRNEASFTACLD
1oxwA           ---------VLSIDGGGIRGIIPATILEFLEGQLQEXDNNADARLADYFDVISTPNENNRPFAAAKEIVP
1cjyA2          -----VPVVAILGSGGGFRAMGFSGVMKALYESGILDCATYGLSGSTWYMSTLLTPQKVKRYVESLWKKK


                         .         .         *         .         .         .         .:140
query           DLSFRWWVMPFVDADGVGAALHGDARVRSSCALPFDFDAFQANPARVTLQAIDRDTGETVCFTRGDFPTE
1oxwA           FYFEHGPQI-FNPSGQILGPKYDGKYLXQVLQEKLGETRVHQALTEVVISSFDIKTNKPVIFTKSNLANS
1cjyA2          SSGQPVTFTDIFG--MLIGETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSP


                         +         .         .         .         .         *         .:210
query           QTLMERVRASTSYPIVLPPTVVDGRALYDXXXXXXXXXMVPRAMDDGLSRFFVVCTRPRGFRRPLKPNRF
1oxwA           PELDAKSYSTAAAPTYFPPHYFVTN---------------------------------------------
1cjyA2          ------YEIGMAKYGTFMAPDLFGSKFFMGTVVKKYE--ENPLHFLMGVWGSAFSILFNRVLSTMEEELE


                         .         .         .         +         .         .         .:280
query           YDAFFWRRPRMREALDTWNRRYDAELDRLDRLEAEGRAYVFYANDQGVKNTERDAEKLARNYERGRMQAL
1oxwA           ----------------------------------------------------------------------
1cjyA2          NITTKHI--VSNNQASWIHRMIMALVSDSALFNTR-EGRAGKVHNFMLGLNLDVKSKKIHVVDSGLTFNL


                         .         *         .         .         .         .         +:350
query           SEFDRWxxxxxxxxx
1oxwA           ---------------
1cjyA2          PYPLIL---------