[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV56230.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1heiB1.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"

## Summary of PDB Search
:264
    1e-16  20%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-15  18%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    3e-15  17%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    7e-15  24%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    5e-14  12%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    4e-13  19%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    3e-12  15%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    4e-12  23%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    7e-12  16%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    1e-11  19%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    2e-11  26%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    2e-11  14%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-11  30%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    8e-11  18%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    2e-10   5%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    2e-10  13%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    4e-10  10%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    4e-10   6%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    5e-10   3%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    9e-10  16%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    1e-09  16%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    2e-09   7%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    2e-09  17%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    3e-09   9%  1mi8A  [b.86.1.2] DNAB INTEIN
    5e-09  11%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    6e-09  15%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    6e-09   2%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    6e-09  23%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    1e-08  17%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    2e-08  14%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    2e-08  16%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    2e-08   8%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    2e-08  10%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    2e-08  17%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    2e-08  35%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    3e-08  10%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    3e-08  14%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    6e-08  14%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    7e-08  15%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    7e-08  13%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    7e-08  16%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    1e-07  10%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    1e-07  11%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    1e-07   9%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    2e-07  16%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    2e-07  26%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    2e-07  15%  1g6oA  [c.37.1.11] CAG-ALPHA
    2e-07  29%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    2e-07  14%  1jbkA  [c.37.1.20] CLPB PROTEIN
    3e-07  18%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    4e-07  14%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    4e-07  26%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    4e-07  25%  1jb1A  [c.91.1.2] HPRK PROTEIN
    4e-07  17%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    7e-07  18%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    8e-07  16%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    1e-06  14%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    1e-06  17%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    2e-06  18%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    3e-06  15%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    3e-06  14%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    3e-06  22%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    5e-06  23%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    6e-06   8%  1t3wA  [a.236.1.1] DNA PRIMASE
    7e-06   8%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    7e-06  39%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    9e-06  19%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    1e-05  10%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    1e-05  14%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    3e-05  12%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    3e-05  39%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177
    4e-05  43%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351
    5e-05   9%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    1e-04  16%  1heiB1 [c.37.1.14] HCV HELICASE B:188 -- 325
    2e-04  26%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    3e-04  16%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    4e-04  20%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    4e-04  11%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    7e-04  31%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    9e-04  13%  1rkbA  [c.37.1.1] PROTEIN AD-004
:264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTITTRDSLLTIRGLSASVDETPILHDIDLAVGPGETHVIMGPNGAGKSTLGHVVMGDAAYRMDGGSVEF
1q3hA           ------ELLEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILG--ELEASEGIIKH
1sgwA           -------SKLEIRDLSVGYDK-PVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTY--LKPLKGEIIY
1b0uA           -------NKLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINF--LEKPSEGAIIV
1ji0A           ------DIVLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKG--KIIF
1e9rA           ---------GKLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYT--GLLRGDRMVI
1qhdA1          ----------------------EYIENWNLQNRRQRTSVLADASETMLANVTSVRQE---YAIPVGPVFP
1e69A           -----------------------SFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKW--VFGEKFDMIFA
1pf4A1          YEAERVNGEVDVKDVTFTYQEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRF--YDVDSGSICL
1e3mA2          ----IDKPGIRITEGRHPVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTAL--IALXAYIGSYV
1pv4A3          -------------------DLTARVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQS--IAYNHPDCVL
1l7vC           ------------------VAESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAG---XTSGKGSIQF
1khbA1          -------------------AEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSL--PGWKVECVGD
1vplA           ---------VVVKDLRKRIGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIIS--------------
1urjA           -----------------------VTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVH--RIPVYPLQLFM
1m3eA1          ----------------------TDAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLK--TGVKELTAVS
1ckvA           MSVNSNAYDAGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYVEDRAGYWWI
1grqA           ----------------------------------TRMIILNGGSSAGKSGIVRCLQS--VLPEPWLAFGV
1l7lA           -----------------------WKGEVLANNEAGQVTSIIYNPGDVITI--VAAGWASYGPTQKWGPQG
2gtlM1          --------VTITAAHRKSFVWLRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAP---LKGQSEGYGV
1fl9A           --------YIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQ-------------
2je6I3          --------------------------GIVIDIMPVKVPRVIGKNKSMYETLTSKSI----FVANNGRIWA
1b77A2          ------------------------VASVITEIKAEDLQQLL-----RVSRGLQIDTIA--ITNKDGKIVI
1mjgM           ---------IKLTKIKLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSE---SEITDGKIEV
1mi8A           ISLASTGKRVSIKDLLDEKFEIWAINEQTMKLESAKVS-RVFMTGKKLVYILKTRLGR--TIKATANHRF
1jqjA3          ----------------AAAASNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVT-------------Y
1xbtA1          ----------------------------------GQIQVILGPMFSGKSTELMRRVR--RFQIAQYKCLV
1afrA           ------------------MPPREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKP--VEKCWQPQDFL
1g8yA           -------ATHKPINILEAFAAPPPLDYVLPNMVAGTVGALVSPGGAGKSML-------------------
3cddA2          ------EIVLKAGGKIYQGGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEP-----------------
1nijA1          ---------------------------------PIAVTLLTGFLGAGKTTLLRHILN--EQHGYKIAVIE
1ni3A1          --------------------------VQWGRPGNNLKTGIVGXPNVGKSTFFRAITK--SVLGNPANYPY
2vnuD1          ------KVRIRTRRAAELLDKRIVISIDSWPTTLGHFVRDLGTIESAQAETEALLLE-------------
1l1oA           --------------------PRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFIL----SDGEGKNGTI
1lw7A2          ----------------------------EARPFFAKTVAILGGESSGKSVLVNKLAA--VFNTTSAWEYG
1g6hA           -------EILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGF--LKADEGRVYF
1kgdA           ---------------------------------MRKTLVLLGAHGVGRRHIKNTLIT--KHPDRFAYPIP
1i1qA           RYVADLTKVDRYSYVMHLVVVGELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIAD--AEGQRRG----
1tueA           -----------------------ALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIH----FIQGAVISF
1c4oA1          -----------YRGPSPKGDQPKAIAGLVEALRDGERFVLLGATGTGKTVTMAKVIEA--LGRPALVLAP
1atrA1          --------------------------GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGN--RTTPSYVAFT
2v3jA1          ----------------------PQAPVLTSKDKITKRXIVVLAXASLETHKIYVLLN---CDDHQGLLKK
1ovmA2          -------------------NELNASYAADGYARCKGFAALLTTFGVGELSAMNGIAGS--YAEHVPVLHI
1jalA1          ----------------------------------GFKCGIVGLPNVGKSTLFNALTKA--GPFCTIEPNT
1cd5A           -----KAGQVSFKHVVTFMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGN--APDIDAECRQ
1ffhA2          --------------------------ARLPVLKDRNLWFLVGLQGSGKTTTAA--KLALYYKGKGRRPLL
1ex6A           -----------------------------------RPIVISGPSGTGKSTLLKKLFAE--YPDSFGFSVS
1g6oA           -----------QGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIED
1tmkA           --------------------------------GRGKLILIEGLDRTGKTTQCNILY--------------
1jbkA           ---------AEQGKLDPVIGRDEEIRRTVLQRRTKNNPVLIGEPGVGKTAIVEGLAQR--IINGEVPEGL
1e6cA           -----------------------------------EPIFMVGARGCGMTTVGRELAR--ALGYEFVDTDI
1udwA           ----------------------------------PFLIGVSGGTASGKSSVCAKIVQL--LQKQVVILSQ
1d6jA           ----------------------TRSERTELRNQRGLTIWLTGLSASGKSTLAVELE--------------
1jb1A           --------------------ERRSXHGVLVDI-YGLGVLITGDSGVGKSETALELVQ-------------
1qhlA           ---------GKFRSLT--LINWNGFFARTFDL-DELVTTLSGGNGAGKSTTMAAFVTA--LIPDLTLLLH
2ancF1          ----------------------------------GTLYIVSAPSGAGKSSLIQALLKT--QPLYDTQEAI
1yr6A1          --------------------------------------VFVGTAGSGKTTLTGEFGR--YLEDNYKVAYV
1esmA           -------------------QAVLEQFLGTNGQRIPYIISIAGSVAVGK----------------------
2iqhA1          --------------SGGNTSSGQISIQPTFSVQRNLPFDRPTIMAASDMRTEIIRLMESA---RPEDVSF
1jjvA           ----------------------------------TYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVV--
1s9hA           -----------------------FLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAH--TVPFYGCVNWT
1t06A           -----------------------------EALGKERTKKIYISNGAHEPVFGVATGA----MKPIAKKIK
1zp6A1          ----------------------------------GNILLLSGHPGSGKSTIAE--ALANLPGVPKVHFHS
1cr0A           ----------------------TGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGK-----
1t3wA           -----------------------------------------------KRTTXRILIGLLVQNPELATLVP
2yyeA2          ------------------------------GAQVGQLLILTKPIGTGILIKGLKEGIL--KEEDINEAIE
1viaA           -----------------------------------KNIVFIGFXGSGKSTLARALAKD------------
1n25A           -------------------------KCMVYNIPKKRYWLFKGPIDSGKTTLAAALLE-------------
1bmfA3          ---------IPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTII--NQKRFNDGTDE
1g8fA3          -------------------------------PKQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYIF
1mukA           ------------------------LLEAYLLV-----KWRMCEAREPSVDLRLPLC--AGIDPLNSDPFL
1ak2A1          ----------------------------------GVRAVLLGPPGAGKGTQAPKLAK-------------
1yj5A2          -----------------------------------EVVVAVGFPGAGKSTFIQEHL--------------
2axpA1          --------------------------------------ILEGPDCCFKSTVAAKLSK--ELKYPIIKGSS
1heiB1          --------------------------SPPAVPQSFQVAHLHAPTGSGKSTKVPAAYA--AQGYKVLVLNP
1np6A           ----------------------------------IPLLAFAAWSGTGKTTLLK-----------------
1e2hA           ---------------------------------TLLRVYIDGPHGMGKTTTTQLLRD--DIVYVPEPMTY
1w1wA           ---------LELSNFKSYRGVTKV------GFGESNFTSIIGPNGSGKSNMMDFVLGDTSYKIDGKTVSY
1tljA           -------------------LREKALNKIYHDKEIGYLDPDILGFLLA-----------------------
1ckeA           ---------------------------------IAPVITIDGPSGAGKGTLCKAMAEALQWHLDSGAI--
1rkbA           ---------------------------------LLPNILLTGTPGVGKTTLGKELASKSGLYINVGDLAR


                         .         .         *         .         .         .         .:140
query           DGRDITDLSPDKRSRAGLFLSFQAPVEIPGVPLSSFLRATVAGRDGKELKGKQFKKHVRTLADELDMDPS
1q3hA           SGRVSFCSQFSWIMPGTIKENIIFGVSYD-----------------------------------------
1sgwA           NGVPITKVKGKIFFLPEEIIVPR--------KISVEDYLKAVASLYGVKVNKNEIMDALESVEVLDLK--
1b0uA           NGQNINLVRDKDGQLKVADKNQRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVG
1ji0A           NGQDITNKPAHVINRXGIALVPEGRRIFPELTVYENLXXGAYNRKDKE-GIKRDLEWIFSLFPRLKERLK
1e9rA           VDPNGDMLSKFGRDKDIILNPYD-----------QRTKGWSFIRNDYDWQRYALSVVPRGKTDEAEEWAS
1qhdA1          PGMNWTDLITN-YSPSRED--NLQRV--------------------------------------------
1e69A           GSENLPPAGSAYVEL-------------------------------------------------------
1pf4A1          DGHDVRDYKLTNLRRHFALVSQN-----------------------------------------------
1e3mA2          PAQKVEIGPIDRIFTRVGF---------------------------------------------------
1pv4A3          XVLLIDERPEEVT---------------------------------------------------------
1l7vC           AGQPLEAWSATKLALHRAYLS-QQQTPPFATPVWHYLTLHQHDKTRTEL--------LNDVAGALALDD-
1khbA1          DIAWMKFDAQGHLRA-------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1urjA           PDFSRVIAEPFNANSIGEKFTYPLPFFNR--PLNRLLFEAVVGPAAVALRSRNVDAVARAAA--------
1m3eA1          NNAGVDNFGLGLLLQSKQIKRXISSYVGENAEFERQYLAGELEVELTPQGTLAERIRAGGAGVPAFYTST
1ckvA           KANGKIEVDCDEI-SELLGRQFNVYDFLVD----------------------------------------
1grqA           DSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAW-------AEGVVAMARAGARIIIDDVFLGGA
1l7lA           DREHPDQGLICHDAF--CGALVMKIGNSGTIPVNTGLF----RWVAPNNVQGAITLIYNDVPGTYGNNSG
2gtlM1          ICDFNLGDDDHADCK-------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2je6I3          FSEEILIEAIRKIEN-------------------------------------------------------
1b77A2          NGYNKVEDSGLTRPKYSLTLTDYDGSNNFNFV--INMANMKIQPGNYKVMLWGAGDKVAAKFESSQVSYV
1mjgM           IGPDIDQIPEGSKLPLG-----------------------------------------------------
1mi8A           LTIDGWKRLDELSLKEHIALPRKSDI--------------------------------------------
1jqjA3          SGAEMEIGFNVSYVLDVLNALKCENVRMMLDSVSSVQIEDAASQSAAYV---------------------
1xbtA1          IKYAKDTRALPACLLRDVAQEALGV---------------------------------------------
1afrA           PDPASDG---------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1nijA1          NEFGEVSVDDQLI-GDRATQIKTLTNGCIC----------------------------------------
1ni3A1          ATIDPEEAKVAVPDERFDWLCYKPKSRVPAFLTVFDIAGLTKGASTGVGLGNAFLSHVR-AVDAIYQVVR
2vnuD1          ----------------------------------------------------------------------
1l1oA           ELMEPLDEEISGIVE-------------------------------------------------------
1lw7A2          REFVFEKLGGDEQ---------------------------------------------------------
1g6hA           ENKDITNKEP------------------------------------------------------------
1kgdA           HTTRPPEENGKNY---------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1tueA           VNSTSHFWLEPLTDTKVAM--LDDATTTCWTYFDTYMRNALDGNPISIDPLIQLKCPPILLTTNIHPAKD
1c4oA1          NKILAAQLAAEFRE----LFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDASINPEIERLRHSTTRSLL
1atrA1          DTERLIGDAAKN----------------------------------------------------------
2v3jA1          XGRDISEARPDITHQCLLT---------------------------------------------------
1ovmA2          VGAPGTAAQQRGELLHHTLGDGE---FRHFYHMSEPITVAQAVLTEQNACYEIDRVLTTMLREYLMLPAD
1jalA1          GVVPMPDPRLDALAE------IVKPERILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVR
1cd5A           YEEKIRS---------------------------------------------------------------
1ffhA2          VAADTQRPAAREQLRL------------------------------------------------------
1ex6A           STTRTPRAGEVNG---------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1jbkA           KGRRV-----------------------------------------------------------------
1e6cA           FMQHTSG---------------------------------------------------------------
1udwA           DSFYRVLTSEQKAKA-------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1qhlA           GKLKAGV---------------------------------------------------------------
2ancF1          EQVLATGVDVFLDID-------------------------------------------------------
1yr6A1          NLDTGVKELPYEPSIDVREFVTVEEIMREGY---------------------------------------
1esmA           ----------------------------------------------------------------------
2iqhA1          QGRGVFELSDEKA-TSPIVPSFDMSNEGS-----------------------------------------
1jjvA           -AREVVAKDSPLLSKIVE----------------------------------------------------
1s9hA           NENFPFNDCVDKM----VIWWEEGKMTAKVVEAKAILGGSKVRVDQKCKSSAQIDPT-------------
1t06A           LNQELAEELYATGNYDAMYF--------------------------------------------------
1zp6A1          DD--------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1t3wA           PLENLDENKLPGLGLFRELVYRGTNNAATLEKLSXWDDIADKNIAEQTFTDSLNHXFDSLLELRARERTH
2yyeA2          NMLALND-KARNLMLSLDATACTDVTGFGLLGHAWNICKNSNIGARIFFEKVPYYQLSENLVKKKIYPKG
1viaA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1bmfA3          KKKLYCIYVAIGQKRSTVAQLVK-----------------------------------------------
1g8fA3          EHNNKTELLSLIQDFIGSIIPDQWEVYLLDTSSSADIQLESADEPISHIVQK------------------
1mukA           KMVSVGPMLQSTRKYFAQ----------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
2axpA1          FELAKSGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHAD
1heiB1          SVGSPITYSTYGKFLADGGCSGGAY---------------------------------------------
1np6A           ----------------------------------------------------------------------
1e2hA           -WRVLGASETIANIYTTQHRLDQ-----------------------------------------------
1w1wA           KDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFTFDYVSDHLDAIYRELTGNLTKYHATPPL
1tljA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1rkbA           EEQLYDGYDEEYDLDEDRVVDELDNQMREGGVI-------------------------------------


                         +         .         .         .         .         *         .:210
query           YLDRELGVGFSGGXXXXXXXXXXXXXXXXXXXXXXTDSGLDVDALGVVSRGIDAYRRATGGALVVITHNT
1q3hA           ----------------------------------------------------------------------
1sgwA           ----KKLGELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSREEL
1b0uA           IDERKYPVHLSGG---------------------------------------------------------
1ji0A           QLGGT----LSGGEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQ-EGTTILLVEQN-
1e9rA           YGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSD--
1qhdA1          ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
1l7vC           KLGRSTN-QLSGGEWQRVRLAAVVLQITPQANPAGQXNSLDVAQQSALDKILSALCQ-QGLAIVXSSHD-
1khbA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1m3eA1          GYGQEGGSPIKYNKDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWK--ADQAGNVTFRKSARN-
1ckvA           ----------------------------------------------------------------------
1grqA           AAQERWRSFVGDLDVLWVGVRCDGAVAEGR------ETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHK
1l7lA           SFSVNIGKD-------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1b77A2          IAME------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ni3A1          AFD-------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1tueA           NRWPYL----------------------------------------------------------------
1c4oA1          TRRDVIVVASVSAIYGLGDPREYRARNLVGFVLFPATHYLSPEGLEEILKEIE-----------------
1atrA1          ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ovmA2          VAKKA-----------------------------------------------------------------
1jalA1          CFENIDPLDDIDTINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPVLENAGMIRSVG--
1cd5A           ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1t3wA           GLSNE-----------------------------------------------------------------
2yyeA2          AIENLNFVLKSNL---------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
2axpA1          PLRVRGDEYIEGK---------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1w1wA           KRFKDME-YLSGGAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRN-PDLQFIVISLKN
1tljA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RILExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1q3hA           ------------------------------------------------------
1sgwA           SY----------------------------------------------------
1b0uA           ------------------------------------------------------
1ji0A           ------------------------------------------------------
1e9rA           ------------------------------------------------------
1qhdA1          ------------------------------------------------------
1e69A           ------------------------------------------------------
1pf4A1          ------------------------------------------------------
1e3mA2          ------------------------------------------------------
1pv4A3          ------------------------------------------------------
1l7vC           ------------------------------------------------------
1khbA1          ------------------------------------------------------
1vplA           ------------------------------------------------------
1urjA           ------------------------------------------------------
1m3eA1          ------------------------------------------------------
1ckvA           ------------------------------------------------------
1grqA           ESIE--------------------------------------------------
1l7lA           ------------------------------------------------------
2gtlM1          ------------------------------------------------------
1fl9A           ------------------------------------------------------
2je6I3          ------------------------------------------------------
1b77A2          ------------------------------------------------------
1mjgM           ------------------------------------------------------
1mi8A           ------------------------------------------------------
1jqjA3          ------------------------------------------------------
1xbtA1          ------------------------------------------------------
1afrA           ------------------------------------------------------
1g8yA           ------------------------------------------------------
3cddA2          ------------------------------------------------------
1nijA1          ------------------------------------------------------
1ni3A1          ------------------------------------------------------
2vnuD1          ------------------------------------------------------
1l1oA           ------------------------------------------------------
1lw7A2          ------------------------------------------------------
1g6hA           ------------------------------------------------------
1kgdA           ------------------------------------------------------
1i1qA           ------------------------------------------------------
1tueA           ------------------------------------------------------
1c4oA1          ------------------------------------------------------
1atrA1          ------------------------------------------------------
2v3jA1          ------------------------------------------------------
1ovmA2          ------------------------------------------------------
1jalA1          ------------------------------------------------------
1cd5A           ------------------------------------------------------
1ffhA2          ------------------------------------------------------
1ex6A           ------------------------------------------------------
1g6oA           ------------------------------------------------------
1tmkA           ------------------------------------------------------
1jbkA           ------------------------------------------------------
1e6cA           ------------------------------------------------------
1udwA           ------------------------------------------------------
1d6jA           ------------------------------------------------------
1jb1A           ------------------------------------------------------
1qhlA           ------------------------------------------------------
2ancF1          ------------------------------------------------------
1yr6A1          ------------------------------------------------------
1esmA           ------------------------------------------------------
2iqhA1          ------------------------------------------------------
1jjvA           ------------------------------------------------------
1s9hA           ------------------------------------------------------
1t06A           ------------------------------------------------------
1zp6A1          ------------------------------------------------------
1cr0A           ------------------------------------------------------
1t3wA           ------------------------------------------------------
2yyeA2          ------------------------------------------------------
1viaA           ------------------------------------------------------
1n25A           ------------------------------------------------------
1bmfA3          ------------------------------------------------------
1g8fA3          ------------------------------------------------------
1mukA           ------------------------------------------------------
1ak2A1          ------------------------------------------------------
1yj5A2          ------------------------------------------------------
2axpA1          ------------------------------------------------------
1heiB1          ------------------------------------------------------
1np6A           ------------------------------------------------------
1e2hA           ------------------------------------------------------
1w1wA           TMFE--------------------------------------------------
1tljA           ------------------------------------------------------
1ckeA           ------------------------------------------------------
1rkbA           ------------------------------------------------------