[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV56840.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ad1A.bssp"
#ERROR : Can't open dsspfile "1f6yA.bssp"
#ERROR : Can't open dsspfile "1cbkA.bssp"
#ERROR : Can't open dsspfile "1q7mA2.bssp"
#ERROR : Can't open dsspfile "1q7mA1.bssp"
#ERROR : Can't open dsspfile "1w37A.bssp"
#ERROR : Can't open dsspfile "1a50A.bssp"
#ERROR : Can't open dsspfile "1dhpA.bssp"
#ERROR : Can't open dsspfile "2qs8A2.bssp"
#ERROR : Can't open dsspfile "1efzA.bssp"
#ERROR : Can't open dsspfile "1nvmA2.bssp"
#ERROR : Can't open dsspfile "1jcjA.bssp"
#ERROR : Can't open dsspfile "1piiA1.bssp"
#ERROR : Can't open dsspfile "1ps9A1.bssp"

## Summary of PDB Search
:435
    5e-74  42%  1ad1A  [c.1.21.1] DIHYDROPTEROATE SYNTHETASE
    1e-39  17%  1f6yA  [c.1.21.2] 5-METHYLTETRAHYDROFOLATE CORRINOID/IRON SULFUR
    6e-36  38%  1cbkA  [d.58.30.1] PROTEIN (7,8-DIHYDRO-6-HYDROXYMETHYLPTERIN-
    6e-28  17%  1q7mA2 [c.1.26.1] 5-METHYLTETRAHYDROFOLATE S-HOMOCYSTEINE A:1 --
    6e-27  15%  1q7mA1 [c.1.21.2] 5-METHYLTETRAHYDROFOLATE S-HOMOCYSTEINE A:301 --
    6e-19  12%  1w37A  [c.1.10.1] 2-KETO-3-DEOXY GLUCONATE ALDOLASE
    9e-12  14%  1a50A  [c.1.2.4] TRYPTOPHAN SYNTHASE (ALPHA CHAIN)
    2e-06  14%  1dhpA  [c.1.10.1] DIHYDRODIPICOLINATE SYNTHASE
    8e-06  20%  2qs8A2 [c.1.9.18] XAA-PRO DIPEPTIDASE A:64 -- 373
    2e-05  16%  1efzA  [c.1.20.1] TRNA-GUANINE TRANSGLYCOSYLASE
    3e-05  18%  1nvmA2 [c.1.10.5] 4-HYDROXY-2-OXOVALERATE ALDOLASE A:2 -- 290
    5e-05  15%  1jcjA  [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    5e-05  17%  1piiA1 [c.1.2.4] N-(5'PHOSPHORIBOSYL)ANTHRANILATE ISOMERASE A:255
    4e-04  18%  1ps9A1 [c.1.4.1] 2,4-DIENOYL-COA REDUCTASE A:1 -- 330
:435

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxEFDTRMPIVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVS
1ad1A           --------------TKIMGILNVTPDSFSDGGKFNNVESAVTRVKAMMDEGADIIDVGGVSTRPGHEMIT
1f6yA           -------------MLIIGERINGMFGDIKRAIQERDPAPVQEWARRQEEGGARALDLN------------
1cbkA           ----------------------------------------------------------------------
1q7mA2          --------------KLVFGDIGPTGELPYPLGSTLFEENFRETVEIMVEEGVDGIIFETFSDILELKAVL
1q7mA1          --------VTFDHFVVIGERINPAGRKKLWAEMQGNEEIVIKEAKTQVEKGAEVLDVNFGIESQ------
1w37A           ---------------------------FTKDNRID-KEKLKIHAENLIRKGIDKLFVNG--TTGLGPSLS
1a50A           ---------------------------FVTLGDPG-IEQSLKIIDTLIDAGADALELGVPFSDPLADGPT
1dhpA           ---------------MFTGSIVAIVTPMDEKGNVC-RASLKKLIDYHVASGTSAIVSVG---TTGESATL
2qs8A2          ----------------------------------NGPYEVYAAVRQRYKDGADGIKIGGVLSVAKSNPQF
1efzA           -------------------------------------NLRQQSADALAEIGFDGYAVGGLAVGEG-----
1nvmA2          -----------------------------DGSHAIRHDDVRAIARALDKAKVDSIEVAHGDGLQGSSGFG
1jcjA           -----------------------------ETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPES
1piiA1          ---------------------------------------RGQDAKAAYDAGAIYGGLIFVATSPRCVNVE
1ps9A1          -----------------------------LVEDGGTFAETVELAQAIEAAGATIINTGIGWHEARIPTIA


                         .         .         *         .         .         .         .:140
query           VDEELARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVRDSDCGLVVMHM
1ad1A           VEEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQWAGYDHRMFQVVAKYDAEIVLMHN
1f6yA           VGDKVSAMEWLVEVTQEVNLTLCLDSTNIKAIEAGLKKNRAMINSTNAEKVEKLFPLAVEHGAALIGLTM
1cbkA           ----------------------------------------------------------------------
1q7mA2          AAREVSRDVFLIAHMTFDKGRSLTGTDPANFAITFDELDIDALGINCSLGPEEILPIFQELDKFLVVEPN
1q7mA1          --IDVRYVEKIVQTLPYVNVPLSLDIQNVDLTERALRAYPGRSLFNSAKVDEEELEMKINLLKKYGGTLI
1w37A           PEEKLENLKAVYDVTNKIFQVGGLNLDDARLAKLSKDFDIVGIASYAPYSEKHLVKYFKT------LCEV
1a50A           IQNANLRAFAAGVTPAQPTIPIGLLMYANLVFNNGIDADSVLVADVPVEESAPFRQAALRHNIAPIFICP
1dhpA           NHDEHADVVMMTLDLADGRIPVANATAEASLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQTDLPQILYNV
2qs8A2          TQEEVDA---VVSAAKDYGXWVAVHAHGAEGXKRAIKAGVDSIEHGT-FXDLEAXDLXIENGTYYVP---
1efzA           -QDEMFRVLDFSVPMLPDDKHYLMGVGKPDDIVGAVERGIDMFDCVLTRSGRNGQAFTWDGPINIRNARF
1nvmA2          RHTDLEYIEAVAGEISHAQIATLLLPGSVHDLKNAYQAGARVVRVATHCTEKQHIEYARN-----LGMDT
1jcjA           ARIMMEVIRDMGVEKTVG-FLPAGGVRTAEDAQKYLAIADELFGADWAD---------------------
1piiA1          QAQEVMAAAPLQ------YVGVFRNHDIADVVDKAKVLSLAAVQLHGNEE-QLYIDTLREALPAHVAIWK
1ps9A1          TPVPRGAFSWVTRKLKGHVLVTTNRINDPQVADDILSRGDA-----------------------------


                         +         .         .         .         .         *         .:210
query           QGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPSQTLELVRNFQEFVRLG
1ad1A           GNG-------NRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEAEVMARLDELVATE
1f6yA           N--------KTGIPKDSDTRLAFAMELVAAADEFGLPMEDLYIDPLILPANVAQDHLKTLQQIKMLADPA
1cbkA           ----------------------------------------------------------------------
1q7mA2          AGKPIVENGKTVYPLKPHDFAVH----IDSYYELGV------NIFGGCCGTTPEHVKLFRKVLGNRKPLQ
1q7mA1          V-----LLMGKDVPKSFEERKEYFEKALKILERHDFSDRVIF-DPGVLPLGAEGKPVEVLKTIEFISSKG
1w37A           SPHPVYLYNYPTGKDIDAKVAKEIGCFTGVKDTIEIIHTLDYKRLNPNMLVYSGSDMLIATVASTGLDGN
1a50A           PNADDDLQVASYGRGYTYLLSRSGVTGAENHHLIEKLKEYHAAPALQGFGIS------------------
1dhpA           PSLPETVGRLAKVKNIIG-IKEATGNLTRVNQIKELVSDDFVL-----LSGDDASAL-------DFMQLG
2qs8A2          --TISAGEFVAEKSKIDNFFPEIVRPKAASVGPQISDTFRKAYEKG------------------------
1efzA           SEDLKPL-DSECHCAVCQKWSRA-----------------------------------------------
1nvmA2          VG---------FLMMSHMIPAEKLAEQGKLMESYGA--TCIYM-ADSGGAMSMNDIRDRMRAFKA--VLK
1jcjA           ----------------------------------------------------------------------
1piiA1          ALSVGETLPAREFQHV------------------------------------------------------
1ps9A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACELGASVVRAHNVAATVAALEGLRPYALIGMGCN
1ad1A           YPVLLATSRKRFTKEMMGYDTPVERDEVTAATTAYGIMKGVRAVRVHNVELNAKLAK-------------
1f6yA           PKTVLGLSNVSQ--------NCQNRPLINRTFLAMAMACGLMSAIADACAATAEILLNQTVYCD------
1cbkA           --------------------------------------------------------------AYIALGSN
1q7mA2          RKK-------------------------------------------------------------------
1q7mA1          FNTTVGLSNLSFGLP--------DRSYYNTAFLVLGISKGLSSAIMNPLDETLMK---------------
1w37A           VAAGSNYLPEVTVTIKKLAMERKIDEALKLQFLHD--EVIEASRIFGSLSSNYVLTKYFQ--GYDLGYPR
1a50A           ----------------------------------------------------------------------
1dhpA           GHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQMPLHNKLFVEPNPIPVKWAC------KELGLVLR
2qs8A2          ----------------------------------------------------------------------
1efzA           ----------------------------------------------------------------------
1nvmA2          PETQVGMHAHHNLS-------------LGVANSIVAVEEGCDRVGAGNAPVFIAVAERL-----------
1jcjA           ----------------------------------------------------------------------
1piiA1          ----------------------------------------------------------------------
1ps9A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VPLVASPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELL
1ad1A           ----------------------------------------------------------------------
1f6yA           ----------------------------------------------------------------------
1cbkA           L----------NTPVEQLHAALKAISQLSNTHLVTTSSFYKSKPLGPQDQPDYVNAVAKIETELSPLKLL
1q7mA2          ----------------------------------------------------------------------
1q7mA1          ----------------------------------------------------------------------
1w37A           PPIFPLDDEEER----------------------------------------------------------
1a50A           ----------------------------------------------------------------------
1dhpA           LPMTPITDSGRETVRAALKHA-------------------------------------------------
2qs8A2          ----------------------------------------------------------------------
1efzA           ----------------------------------------------------------------------
1nvmA2          ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1piiA1          ----------------------------------------------------------------------
1ps9A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQPLLELLPGHVLANDV
1ad1A           ----------------------------------------------------------------------
1f6yA           ----------------------------------------------------------------------
1cbkA           DELQRIENEQGRVRLRRWGERTLDLDILLYGNEIIQNERLTIPHYDMHNREFVIVPLFEIASDLVLPNSQ
1q7mA2          ----------------------------------------------------------------------
1q7mA1          ----------------------------------------------------------------------
1w37A           ----------------------------------------------------------------------
1a50A           ----------------------------------------------------------------------
1dhpA           ----------------------------------------------------------------------
2qs8A2          ----------------------------------------------------------------------
1efzA           ----------------------------------------------------------------------
1nvmA2          ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1piiA1          ----------------------------------------------------------------------
1ps9A1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           PVSxxxxxxxxxxxx
1ad1A           ---------------
1f6yA           ---------------
1cbkA           IIT------------
1q7mA2          ---------------
1q7mA1          ---------------
1w37A           ---------------
1a50A           ---------------
1dhpA           ---------------
2qs8A2          ---------------
1efzA           ---------------
1nvmA2          ---------------
1jcjA           ---------------
1piiA1          ---------------
1ps9A1          ---------------