[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV56911.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1y0bA1.bssp"
#ERROR : Can't open dsspfile "1mzvA.bssp"
#ERROR : Can't open dsspfile "1g2pA.bssp"
#ERROR : Can't open dsspfile "1vchA1.bssp"
#ERROR : Can't open dsspfile "1g9sA.bssp"
#ERROR : Can't open dsspfile "2aeeA1.bssp"
#ERROR : Can't open dsspfile "1o57A2.bssp"
#ERROR : Can't open dsspfile "1vdmA1.bssp"
#ERROR : Can't open dsspfile "1bzyA.bssp"
#ERROR : Can't open dsspfile "1u9yA2.bssp"
#ERROR : Can't open dsspfile "1lh0A.bssp"
#ERROR : Can't open dsspfile "1a95A.bssp"

## Summary of PDB Search
:191
    2e-59  51%  1y0bA1 [c.61.1.1] XANTHINE PHOSPHORIBOSYLTRANSFERASE A:1 -- 191
    1e-18  17%  1mzvA  [c.61.1.1] ADENINE PHOSPHORIBOSYLTRANSFERASE
    6e-15  25%  1g2pA  [c.61.1.1] ADENINE PHOSPHORIBOSYLTRANSFERASE 1
    7e-12  25%  1vchA1 [c.61.1.1] PHOSPHORIBOSYLTRANSFERASE-RELATED PROTEIN A:2 --
    5e-11  12%  1g9sA  [c.61.1.1] HYPOXANTHINE PHOSPHORIBOSYLTRANSFERASE
    2e-10  14%  2aeeA1 [c.61.1.1] OROTATE PHOSPHORIBOSYLTRANSFERASE A:1 -- 208
    3e-10  26%  1o57A2 [c.61.1.1] PUR OPERON REPRESSOR A:75 -- 276
    5e-10  17%  1vdmA1 [c.61.1.1] PURINE PHOSPHORIBOSYLTRANSFERASE A:1 -- 153
    2e-09  13%  1bzyA  [c.61.1.1] HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    4e-09  17%  1u9yA2 [c.61.1.2] RIBOSE-PHOSPHATE PYROPHOSPHOKINASE A:156 -- 284
    4e-08  18%  1lh0A  [c.61.1.1] OMP SYNTHASE
    4e-08  15%  1a95A  [c.61.1.1] XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
:191

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MELLEERIRRDGVVKSEGVLKVDSFLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEASGIGIACVVAR
1y0bA1          -EALKRKIEEEGVVLSDQVLKVDSFLNHQIDPLLXQRIGDEFASRFAKDGITKIVTIESSGIAPAVXTGL
1mzvA           ------------------------------SPETLKAIRDFLVERYRTMSPTHILGFDARGFLFGPMIAV
1g2pA           -QELKLALHQYPNFPSEGILFEDIFRNPGLFQKLIDAFKLHLEEAFPEVKIDYIVGLESRGFLFGPTLAL
1vchA1          ------------------------------DPEFTRAAAEALRPLV-PKEAEILFTTETSPIPLTHVLAE
1g9sA           ---------------------VEVMIPEAEIKARIAELGRQITERYKDSSDMVLVGLLRGSFMFMADLCR
2aeeA1          LDIKAVYLKPEDPFTWASGIKSPIYTDNRSYPKTRDLIENGFVETIKAHFPEVIAGTATAGIPHGAIIAD
1o57A2          VQTLGQSLANPERILPGGYVYLTDILGK---PSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAAS
1vdmA1          --------------------------------WQVDRAIFALAEKLREYKPDVIIGVARGGLIPAVRLSH
1bzyA           ------------------------FIPHGLIMDRTERLARDVMKEMGGHHIV-ALCVLKGGYKFFADLLD
1u9yA2          -----------------------------------------------------VLAPDKGALEFAKTASK
1lh0A           -FALNKQVLKFGEFTLKSGRKSPYFFNAGLTGRDLALLGRFYAEALVDSGIDLLFGPAYKGIPIATTTAV
1a95A           --------------------------------MLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLAR


                         .         .         *         .         .         .         .:140
query           HFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVLIIDDFLANGCALNGLIELV
1y0bA1          KLGVPVVFARKHKSLTLTDNLLTASVYSFTKQTESQIAVSGTHLSDQDHVLIIDDFLANGQAAHGLVSIV
1mzvA           ELGIPFVLMRKADKNAGLLIRSEPYEKEYKEAAPEVMTIRHGSIGKNSRVVLIDDVLATGGTALSGLQLV
1g2pA           ALGVGFVPVRKAGKL--------PGECFKATYESDLFEIQKNAIPAGSNVIIVDDIIATGGSAAAAGELV
1vchA1          ALGLPYVVARRRRR----PYMEDPIIQEVTEVLWLDRRFAEKLLN--QRVVLVSDVVASGETMRAMEKMV
1g9sA           EVQVSHEVDFM-------------------TASSRDLKILKDLDERGKDVLIVEDIIDSGNTLSKVREIL
2aeeA1          KMTLPFAYIRSKPKGNQIEGRV----------------------LKGQKMVIIEDLISTGGSVLDAAAAA
1o57A2          YLNVPVVIVRKDGS--TVSINYV-SGSSNRIQTMSLAKRS---MKTGSNVLIIDDFMKAGGTINGMINLL
1vdmA1          ILGDIPLKVIDVKF---------YKGERGEKPVIT---IPIHGDLKDKRVVIVDDVSDTGKTLEVVIEEV
1bzyA           YIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLV
1u9yA2          ILNAEYDYLEIA---------------------------PKTLDAKDRDVFIVDDIISTGGTMATAVKLL
1lh0A           ALAEHHD-------------KDLPYCFNRKEAKDHGEGGSLVGSALQGRVMLVDDVITAGTAIRESMEII
1a95A           ELGIRHVDT---------------VCISSYNQRELKVLK--RAEGDGEGFIVIDDLVDTGGTAVAIREMY


                         +         .         .         .         .         *         .:210
query           GEAGATVEGIGIAIEKGFQPGGDDLRERGYRLESLAIVERMDPETGEIAFx
1y0bA1          KQAGASIAGIGIVIEKSFQPGRDELVKLGYRVESLARIQSL--EEGKVSF-
1mzvA           EASGAEVVEMVSILTIPFLKAAERIHSTGGRYKNVRFIGLLSEDV------
1g2pA           EQLEANLLEYNFVMELDFLKGRSKLNAPVFTL-------------------
1vchA1          LRAGGHVVARLAVFRQG----------------------------------
1g9sA           SLREPKSLAICTLLD--KPSRREVNVPVEFIGFSIPDEF------------
2aeeA1          SREGADVLGVVAIFTYELPKASQNFKEAGIKLITLSN--------------
1o57A2          DEFNANVAGIGVLVEAEGVDERLV---------------------------
1vdmA1          KKLGAKEIKIACLAMKPWTSVVPDY--------------------------
1bzyA           RQYNPKMVKVASLLV------------------------------------
1u9yA2          KEQGAKKIIAACVHPVLIGDALNKLYSAGVEE-------------------
1lh0A           QAHGATLAGVLISLDRQERGRGEI---------------------------
1a95A           PKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVF----------