[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for elen0:ACV56973.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ti2B2.bssp"
#ERROR : Can't open dsspfile "1h0hB.bssp"
#ERROR : Can't open dsspfile "1kqfB1.bssp"
#ERROR : Can't open dsspfile "2akjA3.bssp"
#ERROR : Can't open dsspfile "1a6lA.bssp"
#ERROR : Can't open dsspfile "1jnrB.bssp"
#ERROR : Can't open dsspfile "1h98A.bssp"
#ERROR : Can't open dsspfile "1gt8A1.bssp"
#ERROR : Can't open dsspfile "1gt8A5.bssp"
#ERROR : Can't open dsspfile "2v4jA1.bssp"
#ERROR : Can't open dsspfile "1hfeL2.bssp"
#ERROR : Can't open dsspfile "1nekB1.bssp"
#ERROR : Can't open dsspfile "1jb0C.bssp"
#ERROR : Can't open dsspfile "1d0cA.bssp"
#ERROR : Can't open dsspfile "2gmhA3.bssp"
#ERROR : Can't open dsspfile "1durA.bssp"
#ERROR : Can't open dsspfile "1bluA.bssp"
#ERROR : Can't open dsspfile "1kf6B1.bssp"
#ERROR : Can't open dsspfile "2v4jB1.bssp"
#ERROR : Can't open dsspfile "2fug91.bssp"
#ERROR : Can't open dsspfile "1b0pA5.bssp"
#ERROR : Can't open dsspfile "2fug34.bssp"
#ERROR : Can't open dsspfile "1xerA.bssp"
#ERROR : Can't open dsspfile "1c4aA3.bssp"
#ERROR : Can't open dsspfile "1iqzA.bssp"

## Summary of PDB Search
:219
    1e-43  32%  1ti2B2 [d.58.1.5] PYROGALLOL HYDROXYTRANSFERASE SMALL SUBUNIT B:1
    3e-35  30%  1h0hB  [d.58.1.5] FORMATE DEHYDROGENASE (SMALL SUBUNIT)
    1e-34  35%  1kqfB1 [d.58.1.5] FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, IRON-
    2e-13   9%  2akjA3 [d.134.1.1] FERREDOXIN--NITRITE REDUCTASE, CHLOROPLAST A:431
    3e-11  17%  1a6lA  [d.58.1.2] FERREDOXIN
    3e-11  16%  1jnrB  [d.58.1.5] ADENYLYLSULFATE REDUCTASE
    7e-11  25%  1h98A  [d.58.1.2] FERREDOXIN
    2e-10  11%  1gt8A1 [a.1.2.2] DIHYDROPYRIMIDINE DEHYDROGENASE A:2 -- 183
    6e-09  16%  1gt8A5 [d.58.1.5] DIHYDROPYRIMIDINE DEHYDROGENASE A:845 -- 1020
    8e-09  19%  2v4jA1 [d.58.1.5] SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT
    3e-08  31%  1hfeL2 [d.58.1.5] PROTEIN (FE-ONLY HYDROGENASE (E.C.1.18.99.1) L:2
    5e-07  16%  1nekB1 [a.1.2.1] SUCCINATE DEHYDROGENASE IRON-SULFUR PROTEIN B:107
    8e-07  23%  1jb0C  [d.58.1.2] PHOTOSYSTEM I IRON-SULFUR CENTER
    2e-06   5%  1d0cA  [d.174.1.1] BOVINE ENDOTHELIAL NITRIC OXIDE SYNTHASE HEME
    3e-06  13%  2gmhA3 [d.58.1.6] ELECTRON TRANSFER FLAVOPROTEIN-UBIQUINONE A:483
    3e-06  38%  1durA  [d.58.1.1] 2[4FE-4S] FERREDOXIN
    3e-06  26%  1bluA  [d.58.1.1] FERREDOXIN
    4e-06  10%  1kf6B1 [a.1.2.1] FUMARATE REDUCTASE IRON-SULFUR PROTEIN B:106 --
    1e-05  15%  2v4jB1 [d.58.1.5] SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT
    1e-05  24%  2fug91 [d.58.1.5] NADH-QUINONE OXIDOREDUCTASE CHAIN 9 9:26 -- 179
    1e-05  11%  1b0pA5 [d.58.1.5] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
    3e-05  14%  2fug34 [d.58.1.5] NADH-QUINONE OXIDOREDUCTASE CHAIN 3 3:96 -- 246
    6e-05  19%  1xerA  [d.58.1.3] FERREDOXIN
    8e-05  16%  1c4aA3 [d.58.1.5] PROTEIN (FE-ONLY HYDROGENASE) A:127 -- 209
    8e-05  10%  1iqzA  [d.58.1.4] FERREDOXIN
:219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MANYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPVQCQHCEN
1ti2B2          MEQYYMVIDVAKCQDCNNCFMGCMDEHELNEWPGYTASMQRGHRWMRRERGTYPRNDINYRPTPCMHCEN
1h0hB           --SKGFFVDTTRCTACRGCQVACKQWHGNPATPTENTGFHQNPPDFNFHTEIDGRIDWLFFPDQCRHCIA
1kqfB1          -AEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPADLSAKSEQNGKLEWLIRKDGCMHCED
2akjA3          ----ILMKGLVACTGSQFCGQAIIETKARALKVTEEVQRLV----------SVTRPVRMHWTGCPNSCGQ
1a6lA           ----------------------------------------------------------FVVTDNCIKCKY
1jnrB           --------------------------------------------------------------DGCKALER
1h98A           ----------------------------------------------------------HVICEPCIGVKD
1gt8A1          TQSHAALHSTLAKKLDKKHWKRNPDKNCFHCEKLENNFDDIKH-------TTLGERGALREAMRCLKCAD
1gt8A5          ---------------------------------------------------------------------G
2v4jA1          --------------------------------------------------EFKPNAGAHSGRDWGKFDIE
1hfeL2          --------------------------------------------------------------------ER
1nekB1          PEQREKLDGLYECILCACCSTSCP---------------------------SFWWNPDKFIGPAGLLAAY
1jb0C           ----------------------------------------------------------------CIGCTQ
1d0cA           -------TLCAQSQQDGPCTPRRCLGSLSQARDFINQYYSSIKGSQAHEERLQEVEAEVASTGTYHLRES
2gmhA3          -----------------------------------------GTNHEHDQPAHLTLKDDSVPVNRNLSIYD
1durA           ----------------------------------------------------------------CIACGA
1bluA           ----------------------------------------------------------------------
1kf6B1          ---------------------------------------------------------PEFIGPAAITLAH
2v4jB1          ----------------------------------------------------------------------
2fug91          --------------------------------------------------GRHVLTRHPNGLEKCIGCS-
1b0pA5          --------VPENCIQCNQCAFVCPHSAILPVLAKEEELVGAPANFTALEAKGKELKGYKFRIQINTLMGC
2fug34          --------LLNHPLDCPTCDKGGACEL---------------------------QDRTVEYGLYEKLPVY
1xerA           ---------------------------------------------------------RTNRQVVGEHSGH
1c4aA3          ----------------------------------------------------------------------
1iqzA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVEKCTLCEQRISQGELPQCV
1ti2B2          APCVAKGNG-AVYQREDGIVLIDPEKAKGKKELLDTCPYGVMYWNEEENVAQKCTMCDDESWAPKMPRCA
1h0hB           PPCKATADME----DESAIIHDDATGCVDYESVISACPYDVPRKVAESNQMAKCDMCIDRITNGLRPACV
1kqfB1          PGCLKACPSAGAIIQYNGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACV
2akjA3          VQVADIGFMGCMTRDENGKPCEGADVFVGGRIGSDSHLGDIYKKAVPC--KDLVPVVAEIL---------
1a6lA           CDCVEVCPVDC-FYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNIT
1jnrB           TACEYICPNDLMTLDKEKAYNREPDMCWECYSCVKMCPQGAIDVRGYVDYSPLGGACVPMRGTSDIMWTV
1h98A           QSCVEVCPVEC-IYDGGDQFYIHPEECIDCGACVPACPVNAIYPEEDVPEQWKSYIEKNRK---------
1gt8A1          APCQKSCPTHLDIFSDNPLGLTCGMVCPTSDLCVGGCNLYATEEGSINIGGLQQFASEVFKAMNIPQIRN
1gt8A5          KALQYLGTFGELSNIEQVVAVIDEEMCINCGKCYMTCNDSGYQAIQFDPETHLPTVTDT---CTGCTLCL
2v4jA1          AEVVNRCPSKC-MKWDGSKLSIDNKECVRCMHCINTMPRALHIGD-------------------------
1hfeL2          IEYEMHTPDPKADPDKLHFVQIDEAKCIGCDTCSQYCPTAAIFGEMGEPHSEACINC---------GQCL
1nekB1          RFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSM-----------------
1jb0C           --CVRACPTDVLEMAGQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGL------------
1d0cA           ELVFGAKQAWRDARDCSSAQEMFTYICNHIKYA--TNRGNLRSAITVFPQRAPGRGDFRIWNSQLVRYAG
2gmhA3          GPEQRFCPAGVYEFVPLERLQINAQNCVHCKTCDIKDPSQNINWVVPE----------------------
1durA           --CKPECPVNC--IQEGSIYAIDADSCIDCGSCASVCPVG------------------------------
1bluA           ---------------------MITDECINCDVCEPECPNGAIS-QGDETYVIEPSLCTECVGHYETSQCV
1kf6B1          RYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESS---------------
2v4jB1          --------------KPPMIDHEWTDQLCEIPLAVASCPTAVRPTKLEIGDKKVNTIAIKNERCMYCGNCY
2fug91          -LCAAACPAVSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMAD------------------
1b0pA5          GNCADICPPKEKAL-VMQPLDTQRDAQVPNLEYAARIP--------------------------------
2fug34          TRFEFTRRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVEVLDFIERGVHTFIGTMDFGLPSGFSGNIT
1xerA           KVYGPVEPPXVLG-IHGTIVGVDFDLCIADGSCINACPVNVFQWYDTPGHPASEKKADPVNACIFCMACV
1c4aA3          --------------ERSKSLTVDRTKCLLCGRCVNACGKNTETYAMKFLNKNGKTIIGAEDEKCFDDTNC
1iqzA           --DEDGIAYVTLD-DNQGIVEVPDILIDDMMDAFEGCPTDSIKVADEPFDGDPN----------------


                         +         .         .         .         .         *         .:210
query           AQCGARARFFGDLDQGVDNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ti2B2          HNCGSFVYEFLK----------------------------------------------------------
1h0hB           TSCPTGAMNFGDLS--------------------------------------------------------
1kqfB1          KTCPTGAIHFGTKK--------------------------------------------------------
2akjA3          ----------------------------------------------------------------------
1a6lA           EKKDPLPDAED-----------------------------------------------------------
1jnrB           KYRNGKVLRF------------------------------------------------------------
1h98A           ----------------------------------------------------------------------
1gt8A1          PCL-------------------------------------------------------------------
1gt8A5          SVCPIID---------------------------------------------------------------
2v4jA1          ----------------------------------------------------------------------
1hfeL2          THCPENAIYEAQ----------------------------------------------------------
1nekB1          ----------------------------------------------------------------------
1jb0C           ----------------------------------------------------------------------
1d0cA           YRQ-------------------------------------------------------------------
2gmhA3          ----------------------------------------------------------------------
1durA           ----------------------------------------------------------------------
1bluA           EVCPVDCIIKDPS---------------------------------------------------------
1kf6B1          ----------------------------------------------------------------------
2v4jB1          TMCPALPISDGE----------------------------------------------------------
2fug91          ----------------------------------------------------------------------
1b0pA5          ----------------------------------------------------------------------
2fug34          DICPVGALLDLTARFRARN---------------------------------------------------
1xerA           NVC-------------------------------------------------------------------
1c4aA3          LLCGQ-----------------------------------------------------------------
1iqzA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxx
1ti2B2          ---------
1h0hB           ---------
1kqfB1          ---------
2akjA3          ---------
1a6lA           ---------
1jnrB           ---------
1h98A           ---------
1gt8A1          ---------
1gt8A5          ---------
2v4jA1          ---------
1hfeL2          ---------
1nekB1          ---------
1jb0C           ---------
1d0cA           ---------
2gmhA3          ---------
1durA           ---------
1bluA           ---------
1kf6B1          ---------
2v4jB1          ---------
2fug91          ---------
1b0pA5          ---------
2fug34          ---------
1xerA           ---------
1c4aA3          ---------
1iqzA           ---------