[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:ACD30153.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2pxgA.bssp"

## Summary of PDB Search
:118
    7e-07  28%  2pxgA  [x.x.x] OUTER MEMBRANE PROTEIN
:118

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxLSACGIIQPYTAPVPQGKEIKDKKLFEIKPNMTKSEVTYILGSPDIIDTFNPN
2pxgA           -----------------MAGSGII--YKQPIYQGNLIKQNAVEQLQVGQSKQQVSALLGTPSIPDPFHAQ


                         .         .         *         .         .         .         .:140
query           QYVYINTYKRNMQDTQFSESKLILTFNNQDRLIGISGNYAPxxxxxxx
2pxgA           RWDYTST--QRVDRLARTEIKNFTVFFENEQVVRWEGDYFP-------