[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:tmk

[Show Plain Result]

#ERROR : Can't open dsspfile "4tmkA.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "3hjnB.bssp"
#ERROR : Can't open dsspfile "3hjnA.bssp"
#ERROR : Can't open dsspfile "2z0hA.bssp"
#ERROR : Can't open dsspfile "2pbrA.bssp"
#ERROR : Can't open dsspfile "2z0hB.bssp"
#ERROR : Can't open dsspfile "2plrB.bssp"
#ERROR : Can't open dsspfile "2plrA.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "3tmkE.bssp"
#ERROR : Can't open dsspfile "3tmkD.bssp"
#ERROR : Can't open dsspfile "3tmkA.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1nn5A.bssp"
#ERROR : Can't open dsspfile "3tmkC.bssp"
#ERROR : Can't open dsspfile "2v54B.bssp"
#ERROR : Can't open dsspfile "2v54A.bssp"

## Summary of PDB Search
:209
    2e-41  46%  4tmkA  [c.37.1] PROTEIN (THYMIDYLATE KINASE)
    2e-27  35%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    5e-27  36%  2cckB  [x.x.x] THYMIDYLATE KINASE
    6e-27  36%  2cckA  [x.x.x] THYMIDYLATE KINASE
    8e-27  36%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    8e-27  36%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    1e-26  36%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    2e-26  40%  3hjnB  [x.x.x] THYMIDYLATE KINASE
    2e-26  40%  3hjnA  [x.x.x] THYMIDYLATE KINASE
    9e-26  38%  2z0hA  [x.x.x] THYMIDYLATE KINASE
    2e-23  34%  2pbrA  [x.x.x] THYMIDYLATE KINASE
    5e-22  44%  2z0hB  [x.x.x] THYMIDYLATE KINASE
    1e-11  28%  2plrB  [x.x.x] PROBABLE THYMIDYLATE KINASE
    2e-11  28%  2plrA  [x.x.x] PROBABLE THYMIDYLATE KINASE
    8e-11  30%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    8e-11  30%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    1e-10  30%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    1e-10  30%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    2e-10  30%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    2e-10  30%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    4e-10  29%  3tmkE  [c.37.1] THYMIDYLATE KINASE
    4e-10  29%  3tmkD  [c.37.1] THYMIDYLATE KINASE
    4e-10  29%  3tmkA  [c.37.1] THYMIDYLATE KINASE
    5e-10  29%  1e98A  [c.37.1] THYMIDYLATE KINASE
    9e-10  26%  1tmkA  [c.37.1] THYMIDYLATE KINASE
    9e-10  29%  1nn5A  [c.37.1] SIMILAR TO DEOXYTHYMIDYLATE KINASE (THYMIDYLATE
    6e-09  26%  3tmkC  [c.37.1] THYMIDYLATE KINASE
    1e-08  24%  2v54B  [x.x.x] THYMIDYLATE KINASE
    1e-08  24%  2v54A  [x.x.x] THYMIDYLATE KINASE
:209

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSDSELLM
4tmkA           -RSKYIVIEGLEGAGKTTARNVVVETLEQLGIRMVFTREPGGTQLAEKLRSLLLDIKSDEVITDKAEVLM
2ccgA           --SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDIRT--EAML
2cckB           --SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGDMDIR----TEAML
2cckA           --SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVL-----EDMDIRTEAML
2ccjA           --SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDIRT--EAML
2ccgB           --SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDIRT--EAML
2ccjB           --SAFITFEGPEGSGKTTVINEVYHRLVKD-YDVIMTREPGGVPTGEEIRKIVLEGN-DMDIRT--EAML
3hjnB           ----FITFEGIDGSGKSTQIQLLAQYLEKRGKKVILKREPGGTETGEKIRKILL----EEEVTPKAELFL
3hjnA           ----FITFEGIDGSGKSTQIQLLAQYLEKRGKKVILKREPGGTETGEKIRKILL----EEEVTPKAELFL
2z0hA           ----FITFEGIDGSGKSTQIQLLAQYLEKRG-KVILKREPGGTETGEKIRKILL----EEEVTPKAELFL
2pbrA           -----IAFEGIDGSGKTTQAKKLYEYLKQKGYFVSLYREPGGTKVGE----VXXXXXXXXXXXXXXXXXX
2z0hB           ----FITFEGIDGSGKSTQIQLLAQYLEKK---VILKREPGGTETGEKIRKILL----EEEVTPKAELFL
2plrB           -----IAFEGIDGSGKSSQATLLKDWIELKR--DVYLTE------SDWIHDIIKEAKKKDLLTPLTFSLI
2plrA           -----IAFEGIDGSGKSSQATLLKDWIELKR--DVYLTEWNSS---DWIHDIIKEAKKKDLLTPLTFSLI
1e9dA           -----IVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHS---VHL
1e9cA           -----IVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHS---VHL
1e9fA           -----IVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHS---VHL
1e2gA           -----IVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHS---VHL
1e2fA           -----IVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHS---VHL
1e2dA           -----IVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHS---VHL
3tmkE           -RGKLILIEGLDRTGKTTQCNILYKKLQPN--CKLLKFPERSTRIGGLINEYLTDDSFQ---LSDQAIHL
3tmkD           -RGKLILIEGLDRTGKTTQCNILYKKLQPN--CKLLKFPERSTRIGGLINEYLTDDSFQ---LSDQAIHL
3tmkA           -RGKLILIEGLDRTGKTTQCNILYKKLQPN--CKLLKFPERSTRIGGLINEYLTDDSFQ---LSDQAIHL
1e98A           -----IVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHS---VHL
1tmkA           -RGKLILIEGLDRTGKTTQCNILYKKLQPN--CKLLKFPERSTRIGGLINEYLTDDSFQ---LSDQAIHL
1nn5A           -----IVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHS---VHL
3tmkC           -RGKLILIEGLDRTGKTTQCNILYKKLQPN--CKLLKFPERSTRIGGLINEYLTDDSFQ---LSDQAIHL
2v54B           -----IVFEGLDKSGKTTQCMNIMESIPANTIK--YLNFPQRSTVTGKMIDDYLTRK---KTYNDHIVNL
2v54A           -----IVFEGLDKSGKTTQCMNIMESIPANTIK--YLNFPQRSTVTGKMIDDYLTRK---KTYNDHIVNL


                         .         .         *         .         .         .         .:140
query           IYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDP
4tmkA           FYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTP
2ccgA           FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
2cckB           FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
2cckA           FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
2ccjA           FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
2ccgB           FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
2ccjB           FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
3hjnB           FLAS-----RNLIKQYLSEGYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDFATDGLIPDLTFYIDVDV
3hjnA           FLAS-----RNLIKQYLSEGYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDFATDGLIPDLTFYIDVDV
2z0hA           FLASR-----NLLVTEIKQYYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDFATDGLIPDLTFYIDVDV
2pbrA           XXASRSKLIEEKIIPDLKRDKVVILDRFVLSTIAYQGYGKGLDVEFIKNLNEFATRGVKPDITLLLDIPV
2z0hB           FLASR-----NLLVTEIKQYYAVLLDRYTDSSVAYQGFGRNLGKEIVEELNDFATDGLIPDLTFYIDVD-
2plrB           HATDFSDRYERYILP-LKSGFIVISDRYIYTAYA-RDSVRGVDIDWVKKL---YSFAIKPDITFYIRVSP
2plrA           HATDFSDRYERYILP-LKSGFIVISDRYIYTAYA-RDSVRGVDIDWVKKL---YSFAIKPDITFYIRVSP
1e9dA           LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQPD---VGLPKPDLVLFLQ---
1e9cA           LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQPD---VGLPKPDLVLFLQ---
1e9fA           LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---VGLPKPDLVLFLQL--
1e2gA           LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---VGLPKPDLVLFLQ---
1e2fA           LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---VGLPKPDLVLFLQ---
1e2dA           LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---VGLPKPDLVLFLQ---
3tmkE           LFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAGTNGMDLDWCLQPDVGLL---KPDLTLFLDVD-
3tmkD           LFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAGTNGMDLDWCLQPDVGLL---KPDLTLFLDVD-
3tmkA           LFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAGTNGMDLDWCLQPDVGLL---KPDLTLFLDVD-
1e98A           LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---VGLPKPDLVLFLQ---
1tmkA           LFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAGTNGMDLDWCLQPDVGLL---KPDLTLFLSTQ-
1nn5A           LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---VGLPKPDLVLFLQLQL
3tmkC           LFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAGTNGMDLDWCLQPDVGLL---KPDLTLFLSTQD
2v54B           LFCANRWEFASFIQEQLEQGITLIVDRYAFSGVAY-AAAKGASMT----LSKSYESGLKPDLVIFLE---
2v54A           LFCANRWEFASFIQEQLEQGITLIVDRYAFSGVAY-AAAKGASMT----LSKSYESGLKPDLVIFLE---


                         +         .         .         .         .         *         .:210
query           ILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNAIEIDAAKSIQEVEKQIYLILDKHxxxxx
4tmkA           EVGLKRARARGELDRIEQESFDFFNRTRARYLELAAQDKSIHTIDATQPLEAV----------------
2ccgA           EVGRERIIKNSDQNRLDQEDLKFHEKVIEGYQEIINESQRFKSVNADQPLENVVEDTYQTIIKY-----
2cckB           EVGRERIIK----NRLDQEDLKFHEKVIEGYQEIIRFK----SVNADQPLENVVEDTYQTIIKY-----
2cckA           EVGRERIIK---NSRLDQEDLKFHEKVIEGYQEIIRFK----SVNADQPLENVVEDTYQTIIKY-----
2ccjA           EVGRERIIK--NSNRLDQEDLKFHEKVIEGYQEIIHRFKS---VNADQPLENVVEDTYQTIIKY-----
2ccgB           EVGRERIIK----NSLDQEDLKFHEKVIEGYQEIINESQRFKSVNADQPLENVVEDTYQTIIKY-----
2ccjB           EVGRERIIK---NNRLDQEDLKFHEKVIEGYQEIIQRFKS---VNADQPLENVVEDTYQTIIKY-----
3hjnB           ETALKR-------NRFEKR--EFLERVREGYLVLAREPERIVVLDGKRSIEEIHRDV------------
3hjnA           ETALKR------KNRFEKR--EFLERVREGYLVLAREPERIVVLDGKRSIEEIHRDV------------
2z0hA           ETALKR------KNRFEKR--EFLERVREGYLVLAREPERIVVLDGKRSIEEIHRDV------------
2pbrA           DIALRRLKE---KNRFENK--EFLEKVRKGFLELAKEEENVVVIDASGEEEEVFKEI------------
2z0hB           ---------------------------------------------------------------------
2plrB           DIALERIKKSKRKIKPQEAGADIFGLITEVYDKLVKD-ENFIVIDGTKTPKEIQIQI------------
2plrA           DIALERIKKSKRKIKPQEAGADIFGLITEVYDKLVKD-ENFIVIDGTKTPKEIQIQI------------
1e9dA           -LQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTNWKMVDASKSIEAVHEDIRVL---------
1e9cA           -LQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTNWKMVDASKSIEAVHEDIRVL---------
1e9fA           -------QLADAAKRYENGA--FQERALRCFHQLMKDTTNWKMVDASKSIEAVHEDIRVL---------
1e2gA           ---LQLADAAKRGERYENGA--FQERALRCFHQLMKDTTNWKMVDASKSIEAVHEDIRVL---------
1e2fA           -LQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTNWKMVDASKSIEAVHEDIRVL---------
1e2dA           -LQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTNWKMVDASKSIEAVHEDIRVL---------
3tmkE           ----NNAEKSGFGDERYET-VKFQEKVKQTFKEIRKGDESITIVDVTKGIQEVEALIWQIVE-------
3tmkD           ----NNAEKSGFGDERYET-VKFQEKVKQTFKEIRKGDESITIVDVTKGIQEVEALIWQIVE-------
3tmkA           ----NNAEKSGFGDERYET-VKFQEKVKQTFKEIRKGDESITIVDVTKGIQEVEALIWQIVE-------
1e98A           -LQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTNWKMVDASKRIEAVHEEIRVL---------
1tmkA           -FGDERYETVKFQEKVKQTFMKLLD------KEIRKGDESITIVDVTKGIQEVEALIWQIVE-------
1nn5A           ADAAKR-------ERYENGA--FQERALRCFHQLMKDTTNWKMVDASKSIEAVHEDIRVL---------
3tmkC           D---ERYETVKFQEKVKQTFMKLLD------KEIRKGDESITIVDVTKGIQEVEALIWQIVE-------
2v54B           -SGSKEINRNVGEEIYE--DVTFQQKVLQEYKKMIEEGDIHWQIISSEFEEDVKKEL------------
2v54A           -SGSKEINRNVGEEIYE--DVTFQQKVLQEYKKMIEEGDIHWQIISSEFEEDVKKEL------------