[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:rpoC

[Show Plain Result]

#ERROR : Can't open dsspfile "2ghoD.bssp"
#ERROR : Can't open dsspfile "1l9uD.bssp"
#ERROR : Can't open dsspfile "1hqmD.bssp"
#ERROR : Can't open dsspfile "1i6vD.bssp"
#ERROR : Can't open dsspfile "1iw7D.bssp"
#ERROR : Can't open dsspfile "3eqlD.bssp"
#ERROR : Can't open dsspfile "3dxjD.bssp"
#ERROR : Can't open dsspfile "2o5jD.bssp"
#ERROR : Can't open dsspfile "2ppbD.bssp"
#ERROR : Can't open dsspfile "1ynjD.bssp"
#ERROR : Can't open dsspfile "2a6hD.bssp"
#ERROR : Can't open dsspfile "1ddqD.bssp"
#ERROR : Can't open dsspfile "2o5iD.bssp"
#ERROR : Can't open dsspfile "1ynjJ.bssp"
#ERROR : Can't open dsspfile "2waqA.bssp"
#ERROR : Can't open dsspfile "2pmzA.bssp"
#ERROR : Can't open dsspfile "3hkzA.bssp"
#ERROR : Can't open dsspfile "2e2hA.bssp"
#ERROR : Can't open dsspfile "2nvxA.bssp"
#ERROR : Can't open dsspfile "2yu9A.bssp"
#ERROR : Can't open dsspfile "1y1vA.bssp"
#ERROR : Can't open dsspfile "1wcmA.bssp"
#ERROR : Can't open dsspfile "2vumA.bssp"
#ERROR : Can't open dsspfile "2r92A.bssp"
#ERROR : Can't open dsspfile "1r9tA.bssp"
#ERROR : Can't open dsspfile "2nvtA.bssp"
#ERROR : Can't open dsspfile "2nvqA.bssp"
#ERROR : Can't open dsspfile "2ja5A.bssp"
#ERROR : Can't open dsspfile "1i50A.bssp"
#ERROR : Can't open dsspfile "3i4mA.bssp"
#ERROR : Can't open dsspfile "1i3qA.bssp"
#ERROR : Can't open dsspfile "3hozA.bssp"
#ERROR : Can't open dsspfile "3hoyA.bssp"
#ERROR : Can't open dsspfile "3hoxA.bssp"
#ERROR : Can't open dsspfile "3houA.bssp"
#ERROR : Can't open dsspfile "3gtjA.bssp"
#ERROR : Can't open dsspfile "3gtgA.bssp"
#ERROR : Can't open dsspfile "3fkiA.bssp"
#ERROR : Can't open dsspfile "2e2iA.bssp"
#ERROR : Can't open dsspfile "1nikA.bssp"
#ERROR : Can't open dsspfile "1i6hA.bssp"
#ERROR : Can't open dsspfile "1r5uA.bssp"
#ERROR : Can't open dsspfile "1k83A.bssp"
#ERROR : Can't open dsspfile "3h0gM.bssp"
#ERROR : Can't open dsspfile "3h0gA.bssp"
#ERROR : Can't open dsspfile "1twcA.bssp"
#ERROR : Can't open dsspfile "1twgA.bssp"
#ERROR : Can't open dsspfile "1twaA.bssp"
#ERROR : Can't open dsspfile "3cqzA.bssp"
#ERROR : Can't open dsspfile "2aukE.bssp"
#ERROR : Can't open dsspfile "2aukC.bssp"
#ERROR : Can't open dsspfile "2aukB.bssp"
#ERROR : Can't open dsspfile "2aukA.bssp"
#ERROR : Can't open dsspfile "2pmzC.bssp"
#ERROR : Can't open dsspfile "3hkzC.bssp"
#ERROR : Can't open dsspfile "2waqC.bssp"
#ERROR : Can't open dsspfile "2ghoD.bssp"
#ERROR : Can't open dsspfile "1l9uD.bssp"
#ERROR : Can't open dsspfile "1hqmD.bssp"
#ERROR : Can't open dsspfile "1i6vD.bssp"
#ERROR : Can't open dsspfile "1iw7D.bssp"
#ERROR : Can't open dsspfile "3eqlD.bssp"
#ERROR : Can't open dsspfile "3dxjD.bssp"
#ERROR : Can't open dsspfile "2ppbD.bssp"
#ERROR : Can't open dsspfile "2a6hD.bssp"
#ERROR : Can't open dsspfile "1ddqD.bssp"
#ERROR : Can't open dsspfile "2o5iD.bssp"

## Summary of PDB Search
:1417
      0.0  49%  2ghoD  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
      0.0  49%  1l9uD  [i.8.1] RNA POLYMERASE, BETA-PRIME SUBUNIT
      0.0  48%  1hqmD  [i.8.1] DNA-DIRECTED RNA POLYMERASE
      0.0  47%  1i6vD  [e.29.1] DNA-DIRECTED RNA POLYMERASE
    e-171  51%  1iw7D  [e.29.1] RNA POLYMERASE BETA SUBUNIT
    e-171  51%  3eqlD  [x.x.x] DNA-DIRECTED RNA POLYMERASE SUBUNIT BETA'
    e-171  51%  3dxjD  [x.x.x] BACTRIAL RNA POLYMERASE BETA-PRIME SUBUNIT
    e-170  53%  2o5jD  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
    e-169  51%  2ppbD  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
    e-168  51%  1ynjD  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
    e-166  50%  2a6hD  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
    e-165  49%  1ddqD  [x.x.x] DNA-DIRECTED RNA POLYMERASE
    e-164  53%  2o5iD  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
    1e-54  49%  1ynjJ  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
    2e-48  31%  2waqA  [x.x.x] DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
    2e-48  31%  2pmzA  [x.x.x] DNA-DIRECTED RNA POLYMERASE SUBUNIT A
    2e-48  31%  3hkzA  [x.x.x] DNA-DIRECTED RNA POLYMERASE SUBUNIT A'
    1e-42  33%  2e2hA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    4e-42  31%  2nvxA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    6e-42  32%  2yu9A  [x.x.x] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    6e-42  32%  1y1vA  [i.8.1] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    6e-42  32%  1wcmA  [i.8.1] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    6e-42  33%  2vumA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
    6e-42  32%  2r92A  [x.x.x] DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
    6e-42  32%  1r9tA  [i.8.1] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    6e-42  32%  2nvtA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    6e-42  32%  2nvqA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    6e-42  32%  2ja5A  [x.x.x] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    6e-42  32%  1i50A  [e.29.1] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    6e-42  32%  3i4mA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
    6e-42  32%  1i3qA  [e.29.1] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    6e-42  32%  3hozA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
    6e-42  32%  3hoyA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
    6e-42  32%  3hoxA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
    6e-42  32%  3houA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
    6e-42  32%  3gtjA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
    6e-42  32%  3gtgA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
    6e-42  32%  3fkiA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
    6e-42  32%  2e2iA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    6e-41  32%  1nikA  [i.8.1] RPB1
    6e-41  32%  1i6hA  [e.29.1] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    2e-39  32%  1r5uA  [i.8.1] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    2e-32  32%  1k83A  [e.29.1] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    5e-32  35%  3h0gM  [x.x.x] DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
    5e-32  35%  3h0gA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
    5e-30  31%  1twcA  [e.29.1] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    6e-30  31%  1twgA  [e.29.1] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    6e-30  31%  1twaA  [e.29.1] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
    2e-29  32%  3cqzA  [x.x.x] DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
    2e-23  36%  2aukE  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
    2e-23  36%  2aukC  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
    2e-23  36%  2aukB  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
    2e-23  36%  2aukA  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN
    2e-05  38%  2pmzC  [x.x.x] DNA-DIRECTED RNA POLYMERASE SUBUNIT A
    7e-05  45%  3hkzC  [x.x.x] DNA-DIRECTED RNA POLYMERASE SUBUNIT A''
    2e-04  46%  2waqC  [x.x.x] DNA-DIRECTED RNA POLYMERASE RPO1C SUBUNIT
    8e-55  48%  2ghoD  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN(query 1087->1350)
    2e-51  46%  1l9uD  [i.8.1] RNA POLYMERASE, BETA-PRIME SUBUNIT(query 1102->1350)
    3e-53  48%  1hqmD  [i.8.1] DNA-DIRECTED RNA POLYMERASE(query 1087->1350)
    1e-53  48%  1i6vD  [e.29.1] DNA-DIRECTED RNA POLYMERASE(query 1087->1350)
    4e-56  51%  1iw7D  [e.29.1] RNA POLYMERASE BETA SUBUNIT(query 1120->1350)
    4e-56  51%  3eqlD  [x.x.x] DNA-DIRECTED RNA POLYMERASE SUBUNIT BETA'(query 1120->1350)
    4e-56  51%  3dxjD  [x.x.x] BACTRIAL RNA POLYMERASE BETA-PRIME SUBUNIT(query 1120->1350)
    2e-56  49%  2ppbD  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN(query 1087->1350)
    1e-56  50%  2a6hD  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN(query 1087->1350)
    9e-56  47%  1ddqD  [x.x.x] DNA-DIRECTED RNA POLYMERASE(query 1087->1350)
    6e-55  47%  2o5iD  [x.x.x] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN(query 1102->1350)
:1417

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
2ghoD           -----------------VRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECAC
1l9uD           -----------------VRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECAC
1hqmD           -----------------VRIALASPEKIRSWSYGEVEKPET----------EGKVCER-----------C
1i6vD           -----------------VRIALASPEKIRSWSYGEVEKPET----------EAKVCERCAVEVT------
1iw7D           -----------------VRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECAC
3eqlD           -----------------VRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECAC
3dxjD           -----------------VRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECAC
2o5jD           -----------------VRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECAC
2ppbD           -----------------VRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECAC
1ynjD           -----------------VRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECAC
2a6hD           -----------------VRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECAC
1ddqD           ----------------------------------------------------------------------
2o5iD           -----------------VRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECAC
1ynjJ           ----------------------------------------------------------------------
2waqA           ----------------------------------------------------------------------
2pmzA           ----------------------------------------------------------------------
3hkzA           ----------------------------------------------------------------------
2e2hA           ----------------------------------------------------------------------
2nvxA           -------QQYSSAPLRTVKFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNLGSIDRNLKCQTCQE
2yu9A           ----------------------------------------------------------------------
1y1vA           ----------------------------------------------------------------------
1wcmA           ----------------------------------------------------------------------
2vumA           ----------------------------------------------------------------------
2r92A           ----------------------------------------------------------------------
1r9tA           ----------------------------------------------------------------------
2nvtA           ----------------------------------------------------------------------
2nvqA           ----------------------------------------------------------------------
2ja5A           ----------------------------------------------------------------------
1i50A           ----------------------------------------------------------------------
3i4mA           ----------------------------------------------------------------------
1i3qA           ----------------------------------------------------------------------
3hozA           ----------------------------------------------------------------------
3hoyA           ----------------------------------------------------------------------
3hoxA           ----------------------------------------------------------------------
3houA           ----------------------------------------------------------------------
3gtjA           ----------------------------------------------------------------------
3gtgA           ----------------------------------------------------------------------
3fkiA           ----------------------------------------------------------------------
2e2iA           ----------------------------------------------------------------------
1nikA           ----------------------------------------------------------------------
1i6hA           ----------------------------------------------------------------------
1r5uA           ----------------------------------------------------------------------
1k83A           ----------------------------------------------------------------------
3h0gM           ----------------------------------------------------------------------
3h0gA           ----------------------------------------------------------------------
1twcA           ----------------------------------------------------------------------
1twgA           ----------------------------------------------------------------------
1twaA           ----------------------------------------------------------------------
3cqzA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2pmzC           ----------------------------------------------------------------------
3hkzC           ----------------------------------------------------------------------
2waqC           ----------------------------------------------------------------------
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2ppbD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GKYKRLKHXXXXXXXXXXXXXQAKVRRERMGHIDLVCPVVHIWYLKSLPSRIGLFLDMPLKNVEKVLYFE
2ghoD           GKYKRQRFEGKVCERCGVEVTRSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFN
1l9uD           GKYKRQRFEGKVCERCGVEVTRSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFN
1hqmD           G----------------VEVTRSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLFATELEQVLYFN
1i6vD           ---------------------RSIVRRYRMAHIELATPAAHIWFVKDVPSKIATLLDLSATELEQVLYFN
1iw7D           GKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFS
3eqlD           GKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFS
3dxjD           GKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFS
2o5jD           GKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFS
2ppbD           GKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFS
1ynjD           GKYKRQRFEGKVCERCGVEVTRSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFN
2a6hD           GKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFS
1ddqD           ----------------------------------------------------------------------
2o5iD           GKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFS
1ynjJ           ----------------------------------------------------------------------
2waqA           ------------------------------GHIELVRPVIHVGFVKHVYE----FLKATCRRCGRVKISE
2pmzA           ----------------------------------------------------------------------
3hkzA           ----------------------------------------------------------------------
2e2hA           ----------------------------------------------------------------------
2nvxA           GMNECPGH---------------------FGHIDLAKPVFHVGFIAKIK-----------KVCECVCMHC
2yu9A           ----------------------------------------------------------------------
1y1vA           ----------------------------------------------------------------------
1wcmA           ----------------------------------------------------------------------
2vumA           ----------------------------------------------------------------------
2r92A           ----------------------------------------------------------------------
1r9tA           ----------------------------------------------------------------------
2nvtA           ----------------------------------------------------------------------
2nvqA           ----------------------------------------------------------------------
2ja5A           ----------------------------------------------------------------------
1i50A           ----------------------------------------------------------------------
3i4mA           ----------------------------------------------------------------------
1i3qA           ----------------------------------------------------------------------
3hozA           ----------------------------------------------------------------------
3hoyA           ----------------------------------------------------------------------
3hoxA           ----------------------------------------------------------------------
3houA           ----------------------------------------------------------------------
3gtjA           ----------------------------------------------------------------------
3gtgA           ----------------------------------------------------------------------
3fkiA           ----------------------------------------------------------------------
2e2iA           ----------------------------------------------------------------------
1nikA           ----------------------------------------------------------------------
1i6hA           ----------------------------------------------------------------------
1r5uA           ----------------------------------------------------------------------
1k83A           ----------------------------------------------------------------------
3h0gM           ----------------------------------------------------------------------
3h0gA           ----------------------------------------------------------------------
1twcA           ----------------------------------------------------------------------
1twgA           ----------------------------------------------------------------------
1twaA           ----------------------------------------------------------------------
3cqzA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2pmzC           ----------------------------------------------------------------------
3hkzC           ----------------------------------------------------------------------
2waqC           ----------------------------------------------------------------------
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2ppbD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SYIVTDPGMTPLEKKQLLTDEEYAEALENYGYEFEASMGAEAIRDLLADTDIESEIELLQXXXXXXXXXX
2ghoD           KYIVLDPDGVPVEKRQLLTDEEYGG--------IDARMGAEAIQXXXXXXXXXXXXXXXXXXMKHPSXXX
1l9uD           KYIVLDPDGVPVEKRQLLTDEE------------DARMGAEAIQXXXXXXXXXXXXXXXXXXMKHPSXXX
1hqmD           KYIVLDPDGVPVEKRQLLTXXXXXXXXXXXXXXXDARMGAEAIQXXXXXXXXXXXXXXXXXXMKHPSXXX
1i6vD           KYIVLDPDAVPVEKRQLLTXXXXXXXXXXXXXXXDARMGAEAIQXXXXXXXXXXXXXXXXXXMKHPSXXX
1iw7D           KYIVLDPNGVPVEKRQLLTDEEYRE---------------------------------------------
3eqlD           KYIVLDPNGVPVEKRQLLTDEEYRE---------------------------------------------
3dxjD           KYIVLDPNGVPVEKRQLLTDEEYRE---------------------------------------------
2o5jD           KYIVLDPNGVPVEKRQLLTDEEYRE---------------------------------------------
2ppbD           KYIVLDPNGVPVEKRQLLTDEEYRE---------------------------------------------
1ynjD           KYIVLDPDGVPVEKRQLLTDEEYRELRYGKQETYPLPAGVDAL---------------------------
2a6hD           KYIVLDPNGVPVEKRQLLTDEEYRE---------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           KYIVLDPNGVPVEKRQLLTDEEYRE---------------------------------------------
1ynjJ           ----------------------------------------------------------------------
2waqA           DEIEKYSRIYNAIKKRWPSAAEYAQVCPHCGEKQFKILTPSDIRERLEKVP-ESDVEILG----------
2pmzA           ----------------------------------------------------------------------
3hkzA           ----------------------------------------------------------------------
2e2hA           ----------------------------------------------------------------------
2nvxA           GKLLLD------EHNELMRQ---ALAIKDSKKRF-AAIWTLCKTKMVCETDVPSETQLVSRGGCGNTQPT
2yu9A           ----------------------------------------------------------------------
1y1vA           ----------------------------------------------------------------------
1wcmA           ----------------------------------------------------------------------
2vumA           ----------------------------------------------------------------------
2r92A           ----------------------------------------------------------------------
1r9tA           ----------------------------------------------------------------------
2nvtA           ----------------------------------------------------------------------
2nvqA           ----------------------------------------------------------------------
2ja5A           ----------------------------------------------------------------------
1i50A           ----------------------------------------------------------------------
3i4mA           ----------------------------------------------------------------------
1i3qA           ----------------------------------------------------------------------
3hozA           ----------------------------------------------------------------------
3hoyA           ----------------------------------------------------------------------
3hoxA           ----------------------------------------------------------------------
3houA           ----------------------------------------------------------------------
3gtjA           ----------------------------------------------------------------------
3gtgA           ----------------------------------------------------------------------
3fkiA           ----------------------------------------------------------------------
2e2iA           ----------------------------------------------------------------------
1nikA           ----------------------------------------------------------------------
1i6hA           ----------------------------------------------------------------------
1r5uA           ----------------------------------------------------------------------
1k83A           ----------------------------------------------------------------------
3h0gM           ----------------------------------------------------------------------
3h0gA           ----------------------------------------------------------------------
1twcA           ----------------------------------------------------------------------
1twgA           ----------------------------------------------------------------------
1twaA           ----------------------------------------------------------------------
3cqzA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2pmzC           ----------------------------------------------------------------------
3hkzC           ----------------------------------------------------------------------
2waqC           ----------------------------------------------------------------------
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2ppbD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXIKRLRLLETFQASGNKPEWMVMTXXXXXXXXXXXXXXIEGGRFATSDLNDLYXXXXXXXXXXXXX
2ghoD           XXXXXXX-LEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSXXXXXXXXXXXXXXXXXXX
1l9uD           XXXXXXX-LEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSXXXXXXXXXXXXXXXXXXX
1hqmD           XXXXXXX-LEVVRAFLDSGNRPEWMILEAVPVLPPD------------ATSXXXXXXXXXXXXXXXXXXX
1i6vD           XXXXXXX-LEVVRAFLDSGNRPEWMILEAVPVLPPD------------ATSXXXXXXXXXXXXXXXXXXX
1iw7D           --------LEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSXXXXXXXXXXXXXXXXXXX
3eqlD           --------LEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSXXXXXXXXXXXXXXXXXXX
3dxjD           --------LEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSXXXXXXXXXXXXXXXXXXX
2o5jD           --------LEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSXXXXXXXXXXXXXXXXXXX
2ppbD           --------LEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSXXXXXXXXXXXXXXXXXXX
1ynjD           --------LEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSXXXXXXXXXXXXXXXXXXX
2a6hD           --------LEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSXXXXXXXXXXXXXXXXXXX
1ddqD           -------------------NRPEWMILEAVPVLPPD-----------FATSXXXXXXXXXXXXXXXXXXX
2o5iD           --------LEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSXXXXXXXXXXXXXXXXXXX
1ynjJ           ----------------------------------------------------------------------
2waqA           --------------YDPTTSRPEWMILTVLPVPPIT------IRPSIMAEDDLTHKLVDIVRINERLKES
2pmzA           --------------YDPTTSRPEWMILTVLPVPPITI---------RPSEDDLTHKLVDIVRINERLKES
3hkzA           --------------YDPTTSRPEWMILTVLPVPPITI---------RPSEDDLTHKLVDIVRINERLKES
2e2hA           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
2nvxA           IRKDGLKKLRVLSTFNEVFSRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
2yu9A           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
1y1vA           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
1wcmA           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
2vumA           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
2r92A           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
1r9tA           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
2nvtA           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
2nvqA           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
2ja5A           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
1i50A           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
3i4mA           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
1i3qA           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
3hozA           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
3hoyA           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
3hoxA           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
3houA           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
3gtjA           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
3gtgA           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
3fkiA           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
2e2iA           -------------------SRPEWMILTCLXXXXXXXXXSISFNESQRGEDDLTFKLADILKANISLETL
1nikA           ----------------------------------------------------------------------
1i6hA           ----------------------------------------------------------------------
1r5uA           ----------------------------------------------------------------------
1k83A           ----------------------------------------------------------------------
3h0gM           --------------------RPDWMIITVLXXXXXXXXXXXXXDGTSRGEDDLTHKLSDIIKANANVRRC
3h0gA           --------------------RPDWMIITVLXXXXXXXXXXXXXDGTSRGEDDLTHKLSDIIKANANVRRC
1twcA           ----------------------------------------------------------------------
1twgA           ----------------------------------------------------------------------
1twaA           ----------------------------------------------------------------------
3cqzA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2pmzC           ----------------------------------------------------------------------
3hkzC           ----------------------------------------------------------------------
2waqC           ----------------------------------------------------------------------
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2ppbD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXAPDIIVRNEKRMLQEAVDALLDNGRRGRAVTGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGR
2ghoD           XAQGAPEIIIRNEKRMLQEAVDAVIDNGRRGSPVTNGSERPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
1l9uD           XAQGAPEIIIRNEKRMLQEAVDAVIDNGRRGSPVTNGSERPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
1hqmD           XAQGAPEIIIRNEKRMLQEAVDAVIDNGRRGSPVTNGSERPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
1i6vD           XAQGAPEIIIRNEKRMLQEAVDAVIDNGRRGSPVTNGSERPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
1iw7D           XAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
3eqlD           XAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
3dxjD           XAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
2o5jD           XAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
2ppbD           XAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
1ynjD           XAQGAPEIIIRNEKRMLQEAVDAVIDNGRRGSPVTNGSERPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
2a6hD           XAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
1ddqD           XAQGAPEIIIRNEKRMLQEAVDAVIDNGRRGSPVTNGSERPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
2o5iD           XAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGR
1ynjJ           ----------------------------------------------------------------------
2waqA           IDAGAPQLIIEDLWDLLQYHVATYFDNEIPGLPPSKHRSRPLRTLAQRLKGKEGRFRGNLSGKRVDFSSR
2pmzA           IDAGAPQLIIEDLWDLLQYHVATYFDNEIPGLPPSKHRSRPLRTLAQRLKGKEGRFRGNLSGKRVDFSSR
3hkzA           IDAGAPQLIIEDLWDLLQYHVATYFDNEIPGLPPSKHRSRPLRTLAQRLKGKEGRFRGNLSGKRVDFSSR
2e2hA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQAG---RPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
2nvxA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
2yu9A           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
1y1vA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
1wcmA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
2vumA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
2r92A           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
1r9tA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
2nvtA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
2nvqA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
2ja5A           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
1i50A           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
3i4mA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
1i3qA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
3hozA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
3hoyA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
3hoxA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
3houA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
3gtjA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
3gtgA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
3fkiA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
2e2iA           EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
1nikA           ----APHHAIEEAESLLQFHVATYMDND-----IAGQPQAPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
1i6hA           ----APHHAIEEAESLLQFHVATYMDND-----IAGQPQAPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
1r5uA           ----APHHAIEEAESLLQFHVATYMDND-----IAGQPQAPVKSIRARLKGKEGRIRGNLMGKRVDFSAR
1k83A           ----APHHAIEEAESLLQFHVATYMDNDIAGQSIRAR-----------LKGKEGRI--------VDFSAR
3h0gM           EQEGAPAHIVSEYEQLLQFHVATYMDNEIAGQPALQKSGRPLKSIRARLKGKEGRLRGNLMGKRVDFSAR
3h0gA           EQEGAPAHIVSEYEQLLQFHVATYMDNEIAGQPALQKSGRPLKSIRARLKGKEGRLRGNLMGKRVDFSAR
1twcA           ---------------------------------------------------------------RLDFSAR
1twgA           ---------------------------------------------------------------RADFSAR
1twaA           ---------------------------------------------------------------RADFSAR
3cqzA           ----------------------------------------------------------------MDFSAR
2aukE           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2pmzC           ----------------------------------------------------------------------
3hkzC           ----------------------------------------------------------------------
2waqC           ----------------------------------------------------------------------
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2ppbD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SVITVGPSLRLHECGLPKKMALELFKPFVYSKLRLGGHATTIKQAKRMVELEEAVVWDILETVINEHPVL
2ghoD           SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKAFAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
1l9uD           SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKAFAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
1hqmD           SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKAFAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
1i6vD           SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKAFAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
1iw7D           SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
3eqlD           SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
3dxjD           SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
2o5jD           SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
2ppbD           SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
1ynjD           SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKAFAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
2a6hD           SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
1ddqD           SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKAFAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
2o5iD           SVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIVWDALEEVIHGKVVL
1ynjJ           ----------------------------------------------------------------------
2waqA           TVISPDPNISIDEVGVPEIIAIEKLRQFVINGIRPDGRRIDLRYVKDRKELASTLAYVVERHLTDGDVVL
2pmzA           TVISPDPNISIDEVGVPEIIAIEKLRQFVINGIRPDGRRIDLRYVKDRKELASTLAYIIERHLIDGDIVL
3hkzA           TVISPDPNISIDEVGVPEIIAIEKLRQFVINGIRPDGRRIDLRYVKDRKELASTLAYIIERHLIDGDIVL
2e2hA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
2nvxA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
2yu9A           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
1y1vA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
1wcmA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
2vumA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
2r92A           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
1r9tA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
2nvtA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
2nvqA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
2ja5A           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
1i50A           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
3i4mA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
1i3qA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
3hozA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
3hoyA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
3hoxA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
3houA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
3gtjA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
3gtgA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
3fkiA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
2e2iA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
1nikA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
1i6hA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
1r5uA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
1k83A           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
3h0gM           TVITGDPNLSLDELGVPRSIAKTLTYPETVTPIRDTGERIDLRYHKRAGDIPLRYGWRVERHIRDGDVVI
3h0gA           TVITGDPNLSLDELGVPRSIAKTLTYPETVTPIRDTGERIDLRYHKRAGDIPLRYGWRVERHIRDGDVVI
1twcA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
1twgA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
1twaA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
3cqzA           TVISGDPNLELDQVGVPKSIAKTLTYPEVVTPIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVL
2aukE           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2pmzC           ----------------------------------------------------------------------
3hkzC           ----------------------------------------------------------------------
2waqC           ----------------------------------------------------------------------
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2ppbD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LNRAPTLHRLGIQAFEPRLIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLTVESQLEARVLMMSTNNILS
2ghoD           LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
1l9uD           LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
1hqmD           LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
1i6vD           LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
1iw7D           LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
3eqlD           LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
3dxjD           LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
2o5jD           LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
2ppbD           LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
1ynjD           LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
2a6hD           LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
1ddqD           LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
2o5iD           LNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLS
1ynjJ           ----------------------------------------------------------------------
2waqA           FNRQPSLHRISMMAHRVRVLKGLTFRLNLLVCPPYNADFDGDEMNLHVPQSEEAIAEAKEIMLVHKNIIT
2pmzA           FNRQPSLHRISMMAHRVRVLKGLTFRLNLLVCPPYNADFDGDEMNLHVPQSEEAIAEAKEIMLVHKNIIT
3hkzA           FNRQPSLHRISMMAHRVRVLKGLTFRLNLLVCPPYNADFDGDEMNLHVPQSEEAIAEAKEIMLVHKNIIT
2e2hA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
2nvxA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
2yu9A           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
1y1vA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
1wcmA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
2vumA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
2r92A           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
1r9tA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
2nvtA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
2nvqA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
2ja5A           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
1i50A           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
3i4mA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
1i3qA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
3hozA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
3hoyA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
3hoxA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
3houA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
3gtjA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
3gtgA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
3fkiA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
2e2iA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
1nikA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
1i6hA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
1r5uA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
1k83A           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
3h0gM           FNRQPSLHKMSMMGHRIRVMPYSTFRLNLSVTSPYNADFDGDEMNMHVPQSEETRAEIQEITMVPKQIVS
3h0gA           FNRQPSLHKMSMMGHRIRVMPYSTFRLNLSVTSPYNADFDGDEMNMHVPQSEETRAEIQEITMVPKQIVS
1twcA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
1twgA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
1twaA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
3cqzA           FNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS
2aukE           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2pmzC           ----------------------------------------------------------------------
3hkzC           ----------------------------------------------------------------------
2waqC           ----------------------------------------------------------------------
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2ppbD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           PASGQPIITPTQDIVLGLYYITREKEGARGEGKLFSSYEDVSRAYNSGTIDIHAKIKLRIDRQVFDTKGN
2ghoD           PASGEPLAKPSRDIILGLYYITQVRKEKKGAGMAFATPEEALAAYERGEVALNAPIRLKFDEALLAVAHG
1l9uD           PASGEPLAKPSRDIILGLYYITQVRKEKKGAGMAFATPEEALAAYERGEVALNAPIRLKFDEALLAVAHG
1hqmD           PASGEPLAKPSRDIILGLYYITQVRKEKKGAGMAFATPEEALAAYERGEVALNAPIETSVGRLKFDTVTT
1i6vD           PASGEPLAKPSRDIILGLYYITQVRKEKKGAGMAFATPEEALAAYERGEVALNAPIETSVGRLKFDTVTT
1iw7D           PASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVNPDEALLAVAHG
3eqlD           PASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVNPDEALLAVAHG
3dxjD           PASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVNPDEALLAVAHG
2o5jD           PASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVNPDEALLAVAHG
2ppbD           PASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVNPDEALLAVAHG
1ynjD           PASGEPLAKPSRDIILGLYYITQVRKEKKGAGMAFATPEEALAAYERGEVALNAPIRLKFDEALLAVAHG
2a6hD           PASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVNPDEALLAVAHG
1ddqD           PASGEPLAKPSRDIILGLYYITQVRKEKKGAGMAFATPEEALAAYERGEVALNAPIRLKFDEALLAVAHG
2o5iD           PASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVNPDEALLAVAHG
1ynjJ           ----------------------------------------------------------------------
2waqA           PRYGGPIIGAAQDYISGAYXXXXXXXXXXXEAQQILGVADVK--IDLGEPAILAPREYYTGKQVVSALPK
2pmzA           PRYGGPIIGAAQDYISGAYXXXXXXXXXXXEAQQILGVADVK--IDLGEPAILAPREYYTGKQVISALPK
3hkzA           PRYGGPIIGAAQDYISGAYXXXXXXXXXXXEAQQILGVADVK--IDLGEPAILAPREYYTGKQVISALPK
2e2hA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
2nvxA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
2yu9A           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
1y1vA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
1wcmA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
2vumA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
2r92A           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
1r9tA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
2nvtA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
2nvqA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
2ja5A           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
1i50A           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
3i4mA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
1i3qA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
3hozA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
3hoyA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
3hoxA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
3houA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
3gtjA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
3gtgA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
3fkiA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
2e2iA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
1nikA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
1i6hA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
1r5uA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
1k83A           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
3h0gM           PQSNKPVMGIVQDTLAGV----------------------------------------------------
3h0gA           PQSNKPVMGIVQDTLAGV----------------------------------------------------
1twcA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
1twgA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
1twaA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
3cqzA           PQSNKPCMGIVQDTLCGIRKLT-----------LRDTFIELDQVLNDGVIPTPAIIKPK----------P
2aukE           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2pmzC           ----------------------------------------------------------------------
3hkzC           ----------------------------------------------------------------------
2waqC           ----------------------------------------------------------------------
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2ppbD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           TYNEKGVVNTTVGRALLLNILPEGLSFSLLNKVLVKKEISKIINQAFRVLGGKATVVLADKLMYAGFKYS
2ghoD           LLDLQDVVETSPGRILFARIVGEAVGDEKVAQELIKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTLX
1l9uD           LLDLQDVVETSPGRILFARIVGEAVGDEKVAQELIKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTLX
1hqmD           RYLGRR-LETNPGRILFARIVGEAVGDEKVAQELIKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFXXX
1i6vD           RYLGRR-LETSPGRILFARIVGEAVGDEKVAQELIKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTLX
1iw7D           IVDLQDVVETSPGRILFARIVAEAVEDEKVAWELIKNSLKDLVYQAFLRLGMEKTARLLDALKYYXXXXX
3eqlD           IVDLQDVVETSPGRILFARIVAEAVEDEKVAWELIKNSLKDLVYQAFLRLGMEKTARLLDALKYYXXXXX
3dxjD           IVDLQDVVETSPGRILFARIVAEAVEDEKVAWELIKNSLKDLVYQAFLRLGMEKTARLLDALKYYXXXXX
2o5jD           IVDLQDVVETSPGRILFARIVAEAVEDEKVAWELIKNSLKDLVYQAFLRLGMEKTARLLDALKYYXXXXX
2ppbD           IVDLQDVVETSPGRILFARIVAEAVEDEKVAWELIKNSLKDLVYQAFLRLGMEKTARLLDALKYYXXXXX
1ynjD           LLDLQDVVETSPGRILFARIVGEAVGDEKVAQELIKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTLX
2a6hD           IVDLQDVVETSPGRILFARIVAEAVEDEKVAWELIKNSLKDLVYQAFLRLGMEKTARLLDALKYYXXXXX
1ddqD           LLDLQDVVETNPGRILFARIVGEAVGDEKVAQELIKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFXXX
2o5iD           IVDLQDVVETSPGRILFARIVAEAVEDEKVAWELIKNSLKDLVYQAFLRLGMEKTARLLDALKYYXXXXX
1ynjJ           ----------------------------------------------------------------------
2waqA           DFNFHGQANVSSGPRLCKNVIKNGI---LLEGVFDKKAIESILHWLIKEYSDEYGKWLMDNLFRVFIRFV
2pmzA           DFNFHGQANVSSGPRLCKNVIKNGI---LLEGVFDKKAIESILHWLIKEYSDEYGKWLMDNLFRVFIRFV
3hkzA           DFNFHGQANVSSGPRLCKNVIKNGI---LLEGVFDKKAIESILHWLIKEYSDEYGKWLMDNLFRVFIRFV
2e2hA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
2nvxA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
2yu9A           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
1y1vA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
1wcmA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
2vumA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
2r92A           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
1r9tA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
2nvtA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
2nvqA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
2ja5A           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
1i50A           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
3i4mA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
1i3qA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
3hozA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
3hoyA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
3hoxA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
3houA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
3gtjA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
3gtgA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
3fkiA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
2e2iA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
1nikA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
1i6hA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
1r5uA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
1k83A           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
3h0gM           ----------------------------------------------------------------------
3h0gA           ----------------------------------------------------------------------
1twcA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
1twgA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
1twaA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
3cqzA           LWSGKQILSVAIPNGIHLQRFDEGIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWL
2aukE           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2pmzC           ----------------------------------------------------------------------
3hkzC           ----------------------------------------------------------------------
2waqC           ----------------------------------------------------------------------
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2ppbD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           TLSGVSVGVDDMTIPDNXXXXXXXXXXXXXQITEQYQSSLITENERYNNIINIWSKTSDEVGASMMDAIS
2ghoD           XXXXXXXXXXXAVIPEEKQRYLEEADRKLRQIEQAYEMGFLTDRERYDQVIQLWTETTEKV---------
1l9uD           XXXXXXXXXXXAVIPEEKQRYLEEADRKLRQIEQAYEMGFLTDRERYDQVIQLWTETTEKV---------
1hqmD           XXXXXXXXXDDAVIPEEKQRYLEEADRKLRQIEQAYEMGFLTDRERYDQVIQLWTETTEKV---------
1i6vD           XXXXXXXXXXXAVIPEEKQRYLEEADRKLRQIEQAYEMGFLTDRERYDQVIQLWTETTEKV---------
1iw7D           XXXXXXXXXDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKV---------
3eqlD           XXXXXXXXXDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKV---------
3dxjD           XXXXXXXXXDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKV---------
2o5jD           XXXXXXXXXDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKV---------
2ppbD           XXXXXXXXXDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKV---------
1ynjD           XXXXXXXXXXXAVIPEEKQRYLEEADRKLRQIEQAYEMGFLTDRERYDQVIQLWTETTEKV---------
2a6hD           XXXXXXXXXDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKV---------
1ddqD           XXXXXXXXXDDAVIPEEKQRYLEEADRKLRQIEQAYEMGFLTDRERYDQVIQLWTETTEKV---------
2o5iD           XXXXXXXXXDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKV---------
1ynjJ           ----------------------------------------------------------------------
2waqA           ELQGFTMRLEDVSLGDDVKKEI---------YNEIDRAKVEVDNQKYKNLEPIPGRTLEELENYILDTLD
2pmzA           ELQGFTMRLEDVSLGDDVKKEI---------YNEIDRAKVEVDNQKYKNLEPIPGRTLEELENYILDTLD
3hkzA           ELQGFTMRLEDVSLGDDVKKEI---------YNEIDRAKVEVDNQKYKNLEPIPGRTLEELENYILDTLD
2e2hA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
2nvxA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
2yu9A           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
1y1vA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
1wcmA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
2vumA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
2r92A           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
1r9tA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
2nvtA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
2nvqA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
2ja5A           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
1i50A           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
3i4mA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
1i3qA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
3hozA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
3hoyA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
3hoxA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
3houA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
3gtjA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
3gtgA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
3fkiA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
2e2iA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
1nikA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
1i6hA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
1r5uA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
1k83A           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
3h0gM           --NGFSIGIGDIADADTMKEVTRTVKEARRQVAECIQDA---QHNRLKPEPGMTLRESFEAKVSRILNQA
3h0gA           --NGFSIGIGDIADADTMKEVTRTVKEARRQVAECIQDA---QHNRLKPEPGMTLRESFEAKVSRILNQA
1twcA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
1twgA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
1twaA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
3cqzA           LHNGFSTGIGD-TIADGPTMREITETIAEAKVTKEAQANLLTAKHGMDNVVRFLNEARDKAGR-------
2aukE           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2pmzC           ----------------------------------------------------------------------
3hkzC           ----------------------------------------------------------------------
2waqC           ----------------------------------------------------------------------
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2ppbD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           KDTVSINGEKKEIESFNSVYMMAKSGARGSYNQMRQLAGMRGLMAKPDGTMIETAITANFREGLSVLQYF
2ghoD           --TQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGMRGLMQKPSGETFEVPVRSSFREGLTVLEYF
1l9uD           --TQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGMRGLMQKPSGETFEVPVRSSFREGLTVLEYF
1hqmD           --TQAVXXXXXXXXXXXXLYVMAQSGARGNPQQIRQLCGMRGLMQKPSGETFEVPVRSSFREGLTVLEYF
1i6vD           --TQAVXXXXXXXXXXXXLYVMAQSGARGNPQQIRQLCGMRGLMQKPSGETFEVPVRSSFREGLTVLEYF
1iw7D           --TQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYF
3eqlD           --TQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYF
3dxjD           --TQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYF
2o5jD           --TQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYF
2ppbD           --TQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYF
1ynjD           --TQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGMRGLMQKPSGETFEVPVRSSFREGLTVLEYF
2a6hD           --TQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYF
1ddqD           --TQAVXXXXXXXXXXXXLYVMAQSGARGNPQQIRQLCGMRGLMQKPSGETFEVPVRSSFREGLTVLEYF
2o5iD           --TQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYF
1ynjJ           ----------------------------------------------------------------------
2waqA           KRSTAGDIASKYLDPFNFAYVMARTGARGSVLNITQMAAMRGYMTKPYDISPEARIYSSFRTGLKPTELF
2pmzA           KRSTAGDIASKYLDPFNFAYVMARTGARGSVLNITQMAAMRGYMTKPYDISPEARIYSSFRTGLKPTELF
3hkzA           KRSTAGDIASKYLDPFNFAYVMARTGARGSVLNITQMAAMRGYMTKPYDISPEARIYSSFRTGLKPTELF
2e2hA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
2nvxA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
2yu9A           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
1y1vA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
1wcmA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
2vumA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
2r92A           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
1r9tA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
2nvtA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
2nvqA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
2ja5A           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
1i50A           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
3i4mA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
1i3qA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
3hozA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
3hoyA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
3hoxA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
3houA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
3gtjA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
3gtgA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
3fkiA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
2e2iA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
1nikA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
1i6hA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
1r5uA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLP-QEFF
1k83A           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
3h0gM           RDNAGRSAEHS-LKDSNNVKQMVAAGSKGSFSQMSACVGQQIVEGKPFGFKYRTLIENSYLRGLTPQEFF
3h0gA           RDNAGRSAEHS-LKDSNNVKQMVAAGSKGSFSQMSACVGQQIVEGKPFGFKYRTLIENSYLRGLTPQEFF
1twcA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
1twgA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
1twaA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
3cqzA           --LAEVN-----LKDLNNVKQMVMAGSKGSFINIAQMSGKRIAFGFVDRTLPHFSVENSYLRGLTPQEFF
2aukE           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2pmzC           ----------------------------------------------------------------------
3hkzC           ----------------------------------------------------------------------
2waqC           ----------------------------------------------------------------------
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2ppbD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           TSTHGARKGLADTALKTANAGYLTRRLVDVAQDLVVIEEDCGTDDGLMFSAIVEDGEVKVPLVERALGRT
2ghoD           ISSHGARKGGADTALRTADSGYLTRKLVDVAHEIVVREADCGTTNYISVPLFQMD-EVTRTLIESGLGRV
1l9uD           ISSHGARKGGADTALRTADSGYLTRKLVDVAHEIVVREADCGTTNYISVPLFQMD-EVTRTLIESGLGRV
1hqmD           ISSHGARKGGADTALRTADSGYLTRKLVDVAHEIVVREADCGTTKYISVPLFQMD-EVTRTLIESGLGRV
1i6vD           ISSHGARKGGADTALRTADSGYLTRKLVDVAHEIVVREADCGTTNYISVPLFQMD-EVTRTLIESGLGRV
1iw7D           ISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDE------VTRSLRLR
3eqlD           ISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDE------VTRSLRLR
3dxjD           ISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDE------VTRSLRLR
2o5jD           ISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDE------VTRSLRLR
2ppbD           ISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDE------VTRSLRLR
1ynjD           ISSHGARKGGADTALRTADSGYLTRKLVDVAHEIVVREADCGTTNYISVPLFQMD-EVTRTLIESGLGRV
2a6hD           ISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDE------VTRSLRLR
1ddqD           ISSHGARKGGADTALRTADSGYLTRKLVDVAHEIVVREADCGTTKYISVPLFQMD-EVTRTLIESGLGRV
2o5iD           ISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDE------VTRSLRLR
1ynjJ           ----------------------------------------------------------------------
2waqA           FHAAGGREGLVDTAVRTSQSGYMQRRLINALSDL------------------------------------
2pmzA           FHAAGGREGLVDTAVRTSQSGYMQRRLINALSDL------------------------------------
3hkzA           FHAAGGREGLVDTAVRTSQSGYMQRRLINALSDL------------------------------------
2e2hA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
2nvxA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
2yu9A           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
1y1vA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
1wcmA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
2vumA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
2r92A           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
1r9tA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
2nvtA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
2nvqA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
2ja5A           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
1i50A           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
3i4mA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
1i3qA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
3hozA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
3hoyA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
3hoxA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
3houA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
3gtjA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
3gtgA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
3fkiA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
2e2iA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
1nikA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
1i6hA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
1r5uA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
1k83A           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
3h0gM           FHAMAGREGLIDTAVKTAETGYIQRRLVKAMEDVMV----------------------------------
3h0gA           FHAMAGREGLIDTAVKTAETGYIQRRLVKAMEDVMV----------------------------------
1twcA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
1twgA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
1twaA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
3cqzA           FHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV----------------------------------
2aukE           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2pmzC           ----------------------------------------------------------------------
3hkzC           ----------------------------------------------------------------------
2waqC           ----------------------------------------------------------------------
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2ppbD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           LAADVVTEKGVVLLEAGTXXXXXXXXXXXXXGIDMIKVRSPITCKTRRGLCAKCYGRDLARERQVNVGES
2ghoD           LAREVEAEEGRYL---SLEDVHFLIKAAEAGEVREVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
1l9uD           LAREVEAEEGRYL---SLEDVHFLIKAAEAGEVREVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
1hqmD           LAREVEAEEGRYL---SLEDVHFLIKAAEAGEVREVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
1i6vD           LAREVEAEEGRYL---SLEDVHFLIKAAEAGEVREVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
1iw7D           KRADI--EAGLYGXXXXXXXXXXXXXXXXXXYLSMVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
3eqlD           KRADI--EAGLYGXXXXXXXXXXXXXXXXXXYLSMVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
3dxjD           KRADI--EAGLYGXXXXXXXXXXXXXXXXXXYLSMVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
2o5jD           KRADI--EAGLYGXXXXXXXXXXXXXXXXXXYLSMVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
2ppbD           KRADI--EAGLYGXXXXXXXXXXXXXXXXXXYLSMVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
1ynjD           LAREVEAEEGRYL---SLEDVHFLIKAAEAGEVREVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
2a6hD           KRADI--EAGLYGXXXXXXXXXXXXXXXXXXYLSMVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
1ddqD           LAREVEAEEGRYL---SLEDVHFLIKAAEAGEVREVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
2o5iD           KRADI--EAGLYGXXXXXXXXXXXXXXXXXXYLSMVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEA
1ynjJ           ----------------------------------------------------------------------
2waqA           ----------------------------------------------------------------------
2pmzA           ----------------------------------------------------------------------
3hkzA           ----------------------------------------------------------------------
2e2hA           ----------------------------------------------------------------VHPGEM
2nvxA           ----------------------------------------------------------------VHPGEM
2yu9A           ----------------------------------------------------------------VHPGEM
1y1vA           ----------------------------------------------------------------VHPGEM
1wcmA           ----------------------------------------------------------------VHPGEM
2vumA           ----------------------------------------------------------------VHPGEM
2r92A           ----------------------------------------------------------------VHPGEM
1r9tA           ----------------------------------------------------------------VHPGEM
2nvtA           ----------------------------------------------------------------VHPGEM
2nvqA           ----------------------------------------------------------------VHPGEM
2ja5A           ----------------------------------------------------------------VHPGEM
1i50A           ----------------------------------------------------------------VHPGEM
3i4mA           ----------------------------------------------------------------VHPGEM
1i3qA           ----------------------------------------------------------------VHPGEM
3hozA           ----------------------------------------------------------------VHPGEM
3hoyA           ----------------------------------------------------------------VHPGEM
3hoxA           ----------------------------------------------------------------VHPGEM
3houA           ----------------------------------------------------------------VHPGEM
3gtjA           ----------------------------------------------------------------VHPGEM
3gtgA           ----------------------------------------------------------------VHPGEM
3fkiA           ----------------------------------------------------------------VHPGEM
2e2iA           ----------------------------------------------------------------VHPGEM
1nikA           ----------------------------------------------------------------VHPGEM
1i6hA           ----------------------------------------------------------------VHPGEM
1r5uA           ----------------------------------------------------------------VHPGEM
1k83A           ----------------------------------------------------------------VHPGEM
3h0gM           ----------------------------------------------------------------VSPGEM
3h0gA           ----------------------------------------------------------------VSPGEM
1twcA           ----------------------------------------------------------------VHPGEM
1twgA           ----------------------------------------------------------------VHPGEM
1twaA           ----------------------------------------------------------------VHPGEM
3cqzA           ----------------------------------------------------------------VHPGEM
2aukE           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2pmzC           -------------------------------------------------------------------GEA
3hkzC           -------------------------------------------------------------------GEA
2waqC           -------------------------------------------------------------------GEA
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2ppbD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           VGVIAAQSIGEPGTQLTMRTFHTGGAASLGITVSDIKVKTAGKIKFKNIRTVTNKEGQEIVISRAGEIIV
2ghoD           VGVVAAESIGEPGTQLTMRT--TQGLPRV-IELFEARRPKAKAVISEIDGVVRIEEGED----RLSVFVE
1l9uD           VGVVAAESIGEPGTQLTMRTPRV-------IELFEARRPKAKAVISEIDGVVRIEEGED----RLSVFVE
1hqmD           VGVVAAESIGEPGTQLTMR---TGTDITQGLP-RVIELFEARRPKAKAVGVVRIEEGED----RLSVFVE
1i6vD           VGVVAAESIGEPGTQLTMR---TGTDITQGLP-RVIELFEARRPKAKAVGVVRIEEGED----RLSVFVE
1iw7D           VGIVAAQSIGEPGTQLTMRTFHTGGVAG----AADI---TQGLPRVIELFEARRPKAKAVISEIDGVVRI
3eqlD           VGIVAAQSIGEPGTQLTMRTFHTGGVAG----AADI---TQGLPRVIELFEARRPKAKAVISEIDGVVRI
3dxjD           VGIVAAQSIGEPGTQLTMRTFHTGGVAG----AADI---TQGLPRVIELFEARRPKAKAVISEIDGVVRI
2o5jD           VGIVAAQSIGEPGTQLTMRTFHTGGVA-------------------------------------------
2ppbD           VGIVAAQSIGEPGTQLTMRTFHTDITQGLPRVIELFEARPKAKAVISEIDGVVRIEETEEKLS-----VF
1ynjD           VGVVAAESIGEPGTQLTMRT--------------------------------------------------
2a6hD           VGIVAAQSIGEPGTQLTMRDITQG-------LPRVIELFEARRPKAKAV--ISEIDGVVRIEETEEKLSV
1ddqD           VGVVAAESIGEPGTQLTMRTFHTGGVA-VGTDITQIELFEARRPKAKAVGVVRIEEGED----RLSVFVE
2o5iD           VGIVAAQSIGEPGTQL------------------------------------------------------
1ynjJ           ----------------------------------------------------------------------
2waqA           ----------------------------------------------------------------------
2pmzA           ----------------------------------------------------------------------
3hkzA           ----------------------------------------------------------------------
2e2hA           VGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVA-KNMKT-------------------
2nvxA           VGVLAAQSIGEPATQMTLKKVTSG----------------------------------------------
2yu9A           VGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVA-KNMKT-------------------
1y1vA           VGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVA-KNMKT-------------------
1wcmA           VGVLAAQSIGEPATQMTLKKVTSG----------------------------------------------
2vumA           VGVLAAQSIGEPATQMTLNTFHTSGVPRL-----------------------------------------
2r92A           VGVLAAQSIGEPATQMTLKKVTSG----------------------------------------------
1r9tA           VGVLAAQSIGEPATQMTLKKVTSG----------------------------------------------
2nvtA           VGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVA-KNMKT-------------------
2nvqA           VGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVA-KNMKT-------------------
2ja5A           VGVLAAQSIGEPATQMTLKKVTSG----------------------------------------------
1i50A           VGVLAAQSIGEPATQMTLKKVTSG----------------------------------------------
3i4mA           VGVLAAQSIGEPATQMTLK---------------------------------------------------
1i3qA           VGVLAAQSIGEPATQMTLKKVTSG----------------------------------------------
3hozA           VGVLAAQSIGEPATQMTLK---------------------------------------------------
3hoyA           VGVLAAQSIGEPATQMTLSKKVTSGVPRL-----------------------------------------
3hoxA           VGVLAAQSIGEPATQMTLKKVTSG----------------------------------------------
3houA           VGVLAAQSIGEPATQMTLKKVTSG----------------------------------------------
3gtjA           VGVLAAQSIGEPATQMTLNTFH---VASKKVTSGVPRLKEILNVA-KNMKT-------------------
3gtgA           VGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVA-KNMKT-------------------
3fkiA           VGVLAAQSIGEPATQMTLSKKVTSGVPRL-----------------------------------------
2e2iA           VGVLAAQSIGEPATQMTLKKVTSG----------------------------------------------
1nikA           VGVLAAQSIGEPATQMTLKKVTSG----------------------------------------------
1i6hA           VGVLAAQSIGEPATQMTLKKVTSG----------------------------------------------
1r5uA           VGVLAAQSIGEPATQMTLKKVTSG----------------------------------------------
1k83A           VGVLAAQSIGEPATQMTLKKVTSG----------------------------------------------
3h0gM           VGTLAAQSIGEPATQMTLNTFHYAGVSSKNVTLGVPRLKEILNVA-KNIKT-------------------
3h0gA           VGTLAAQSIGEPATQMTLNTFHYAGVSSKNVTLGVPRLKEILNVA-KNIKT-------------------
1twcA           VGVLAAQSIGEPATQMTLKKVTSG----------------------------------------------
1twgA           VGVLAAQSIGEPATQMTLKKVTSG----------------------------------------------
1twaA           VGVLAAQSIGEPATQMTLKKVTSG----------------------------------------------
3cqzA           VGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVA-KNMKT-------------------
2aukE           ---------------------------------SSIQVKNKGSIXXXXXXXXXXXXXXXXITSRNTELKL
2aukC           ---------------------------------SSIQVKNKGSIXXXXXXXXXXXXXXXXITSRNTELKL
2aukB           ---------------------------------SSIQVKNKGSIXXXXXXXXXXXXXXXXITSRNTELKL
2aukA           ---------------------------------SSIQVKNKGSIXXXXXXXXXXXXXXXXITSRNTELKL
2pmzC           IGIVAAQSVGEPGTQMTLRLIEIVDAKKVPSTPRDKALEVARKLEYK--RAIVQKKGDEYIILTDG----
3hkzC           IGIVAAQSVGEPGTQMTL----------------------------------------------------
2waqC           IGIVAAQSVGEPGTQL------------------------------------------------------
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2ppbD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           SDTMGRVREQHKIPMGAVVPLASGKAVEIGDVIATWDPHAQPLITDVAGKVVLEDVIDGITSKHTYDDLT
2ghoD           SEGFSK---EYKLPKDARLLVKDGDYVEAGQPLGAIDPH-------------------------------
1l9uD           SEGFSK---EYKLPKDARLLVKDGDYVEAGQPLGAIDPH-------------------------------
1hqmD           SEGFSK---EYKLPKDARLLVKDGDYVEAGQPLGAIDPH-------------------------------
1i6vD           SEGFSK---EYKLPKDARLLVKDGDYVEAGQPLGAIDPH-------------------------------
1iw7D           EETEEKLSKEYKLPKEARLLVKDGDYVEAGQPLGAIDPH-------------------------------
3eqlD           EETEEKLSKEYKLPKEARLLVKDGDYVEAGQPLGAIDPH-------------------------------
3dxjD           EETEEKLSKEYKLPKEARLLVKDGDYVEAGQPLGAIDPH-------------------------------
2o5jD           ----------------------------------------------------------------------
2ppbD           VESEGFSKE-YKLPKEARLLVKDGDYVEAGQPLGAIDPH-------------------------------
1ynjD           ----------------------------------------------------------------------
2a6hD           FVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLGAIDPH-------------------------------
1ddqD           SEGFSK---EYKLPKDARLLVKDGDYVEAGQPLGAIDPH-------------------------------
2o5iD           ----------------------------------------------------------------------
1ynjJ           ----------------------------------------------------------------------
2waqA           ----------------------------------------------------------------------
2pmzA           ----------------------------------------------------------------------
3hkzA           ----------------------------------------------------------------------
2e2hA           ----------------------------------------------------------------------
2nvxA           ----------------------------------------------------------------------
2yu9A           ----------------------------------------------------------------------
1y1vA           ----------------------------------------------------------------------
1wcmA           ----------------------------------------------------------------------
2vumA           ----------------------------------------------------------------------
2r92A           ----------------------------------------------------------------------
1r9tA           ----------------------------------------------------------------------
2nvtA           ----------------------------------------------------------------------
2nvqA           ----------------------------------------------------------------------
2ja5A           ----------------------------------------------------------------------
1i50A           ----------------------------------------------------------------------
3i4mA           ----------------------------------------------------------------------
1i3qA           ----------------------------------------------------------------------
3hozA           ----------------------------------------------------------------------
3hoyA           ----------------------------------------------------------------------
3hoxA           ----------------------------------------------------------------------
3houA           ----------------------------------------------------------------------
3gtjA           ----------------------------------------------------------------------
3gtgA           ----------------------------------------------------------------------
3fkiA           ----------------------------------------------------------------------
2e2iA           ----------------------------------------------------------------------
1nikA           ----------------------------------------------------------------------
1i6hA           ----------------------------------------------------------------------
1r5uA           ----------------------------------------------------------------------
1k83A           ----------------------------------------------------------------------
3h0gM           ----------------------------------------------------------------------
3h0gA           ----------------------------------------------------------------------
1twcA           ----------------------------------------------------------------------
1twgA           ----------------------------------------------------------------------
1twaA           ----------------------------------------------------------------------
3cqzA           ----------------------------------------------------------------------
2aukE           IDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELT
2aukC           IDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELT
2aukB           IDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELT
2aukA           IDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELT
2pmzC           ----------------------------------------------------------------------
3hkzC           ----------------------------------------------------------------------
2waqC           ----------------------------------------------------------------------
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2ppbD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           GQQTIEITSISQRTTSKNLKPVVKIVDEKGAKLKSIPLAVGAVLNVADDSILEVGDIVAKIPLEGSKNKD
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2o5jD           ----------------------------------------------------------------------
2ppbD           ----------------------------------------------------------------------
1ynjD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------
1ynjJ           ----------------------------------------------------------------------
2waqA           ----------------------------------------------------------------------
2pmzA           ----------------------------------------------------------------------
3hkzA           ----------------------------------------------------------------------
2e2hA           ----------------------------------------------------------------------
2nvxA           ----------------------------------------------------------------------
2yu9A           ----------------------------------------------------------------------
1y1vA           ----------------------------------------------------------------------
1wcmA           ----------------------------------------------------------------------
2vumA           ----------------------------------------------------------------------
2r92A           ----------------------------------------------------------------------
1r9tA           ----------------------------------------------------------------------
2nvtA           ----------------------------------------------------------------------
2nvqA           ----------------------------------------------------------------------
2ja5A           ----------------------------------------------------------------------
1i50A           ----------------------------------------------------------------------
3i4mA           ----------------------------------------------------------------------
1i3qA           ----------------------------------------------------------------------
3hozA           ----------------------------------------------------------------------
3hoyA           ----------------------------------------------------------------------
3hoxA           ----------------------------------------------------------------------
3houA           ----------------------------------------------------------------------
3gtjA           ----------------------------------------------------------------------
3gtgA           ----------------------------------------------------------------------
3fkiA           ----------------------------------------------------------------------
2e2iA           ----------------------------------------------------------------------
1nikA           ----------------------------------------------------------------------
1i6hA           ----------------------------------------------------------------------
1r5uA           ----------------------------------------------------------------------
1k83A           ----------------------------------------------------------------------
3h0gM           ----------------------------------------------------------------------
3h0gA           ----------------------------------------------------------------------
1twcA           ----------------------------------------------------------------------
1twgA           ----------------------------------------------------------------------
1twaA           ----------------------------------------------------------------------
3cqzA           ----------------------------------------------------------------------
2aukE           GLSSLVVLDSAERTAGKDLRPALKIVDAQGNDV-LIPLPGKAIVQLEDGVQISSGDTLARIPQE------
2aukC           GLSSLVVLDSAERTAGKDLRPALKIVDAQGNDV-LIPLPGKAIVQLEDGVQISSGDTLARIPQE------
2aukB           GLSSLVVLDSAERTAGKDLRPALKIVDAQGNDV-LIPLPGKAIVQLEDGVQISSGDTLARIPQE------
2aukA           GLSSLVVLDSAERTAGKDLRPALKIVDAQGNDV-LIPLPGKAIVQLEDGVQISSGDTLARIPQE------
2pmzC           ----------------------------------------------------------------------
3hkzC           ----------------------------------------------------------------------
2waqC           ----------------------------------------------------------------------
2ghoD           ------------------------------------PVSIGAVGVVAAESIGEPGTQLTM---------R
1l9uD           ---------------------------------------------------VSIGEAVGVVAAEGEPGTQ
1hqmD           ------------------------------------PVSIGAVGVVAAESIGEPGT-----QLTMRTGTD
1i6vD           ------------------------------------PVSIGAVGVVAAESIGEPGT-----QLTMRTGTD
1iw7D           ---------------------------------------------------------------------D
3eqlD           ---------------------------------------------------------------------D
3dxjD           ---------------------------------------------------------------------D
2ppbD           ------------------------------------PVSIGAVGIVAAQSIGEPGTQLTMRTF----HTD
2a6hD           ------------------------------------PVSIGAVGIVAAQSIGEPGTQLTM--------RD
1ddqD           ------------------------------------PVSIGAVGVVAAESIGEPGTQLTMRTFHTAVGTD
2o5iD           ---------------------------------------------------VSIGEAVGIVAAQSIGEPG


                         .         .         +         .         .         .         .:1190
query           ITGGLPRVAELFEARRPKDAAILSPCDGMVRLGNRDTKEKQRIEIIDKNGHIVEEILLPKSRHLVVFDGE
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2o5jD           ----------------------------------------------------------------------
2ppbD           ----------------------------------------------------------------------
1ynjD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------
1ynjJ           -TQGLPRVIELFEARRPKAKAVISEIDGVVRI----EEGEDRLSVFVESEGFSKEYKLPKDARLLVKDGD
2waqA           ----------------------------------------------------------------------
2pmzA           ----------------------------------------------------------------------
3hkzA           ----------------------------------------------------------------------
2e2hA           ----------------------------------------------------------------------
2nvxA           ----------------------------------------------------------------------
2yu9A           ----------------------------------------------------------------------
1y1vA           ----------------------------------------------------------------------
1wcmA           ----------------------------------------------------------------------
2vumA           ----------------------------------------------------------------------
2r92A           ----------------------------------------------------------------------
1r9tA           ----------------------------------------------------------------------
2nvtA           ----------------------------------------------------------------------
2nvqA           ----------------------------------------------------------------------
2ja5A           ----------------------------------------------------------------------
1i50A           ----------------------------------------------------------------------
3i4mA           ----------------------------------------------------------------------
1i3qA           ----------------------------------------------------------------------
3hozA           ----------------------------------------------------------------------
3hoyA           ----------------------------------------------------------------------
3hoxA           ----------------------------------------------------------------------
3houA           ----------------------------------------------------------------------
3gtjA           ----------------------------------------------------------------------
3gtgA           ----------------------------------------------------------------------
3fkiA           ----------------------------------------------------------------------
2e2iA           ----------------------------------------------------------------------
1nikA           ----------------------------------------------------------------------
1i6hA           ----------------------------------------------------------------------
1r5uA           ----------------------------------------------------------------------
1k83A           ----------------------------------------------------------------------
3h0gM           ----------------------------------------------------------------------
3h0gA           ----------------------------------------------------------------------
1twcA           ----------------------------------------------------------------------
1twgA           ----------------------------------------------------------------------
1twaA           ----------------------------------------------------------------------
3cqzA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2pmzC           ----------------------------------------------------------------------
3hkzC           ----------------------------------------------------------------------
2waqC           ----------------------------------------------------------------------
2ghoD           TTQGLPRVIELFEARRPKAKAVISEIDGVVRI----EEGEDRLSVFVESEGFSKEYKLPKDARLLVKDGD
1l9uD           LTMRTPRVIELFEARRPKAKAVISEIDGVVRI----EEGEDRLSVFVESEGFSKEYKLPKDARLLVKDGD
1hqmD           ITQGLPRVIELFEARRPKAKAVISEIDGVVRI----EEGEDRLSVFVESEGFSKEYKLPKDARLLVKDGD
1i6vD           ITQGLPRVIELFEARRPKAKAVISEIDGVVRI----EEGEDRLSVFVESEGFSKEYKLPKDARLLVKDGD
1iw7D           ITQGLPRVIELFEARRPKAKAVISEIDGVVRI--EETEEKLSV-FVESEG-FSKEYKLPKEARLLVKDGD
3eqlD           ITQGLPRVIELFEARRPKAKAVISEIDGVVRI--EETEEKLSV-FVESEG-FSKEYKLPKEARLLVKDGD
3dxjD           ITQGLPRVIELFEARRPKAKAVISEIDGVVRI--EETEEKLSV-FVESEG-FSKEYKLPKEARLLVKDGD
2ppbD           ITQGLPRVIELFEARRPKAKAVISEIDGVVRI--EETEEKLSV-FVESEG-FSKEYKLPKEARLLVKDGD
2a6hD           ITQGLPRVIELFEARRPKAKAVISEIDGVVRI--EETEEKLSV-FVESEG-FSKEYKLPKEARLLVKDGD
1ddqD           ITQGLPRVIELFEARRPKAKAVISEIDGVVRI----EEGEDRLSVFVESEGFSKEYKLPKDARLLVKDGD
2o5iD           TQLGLPRVIELFEARRPKAKAVISEIDGVVRI--EETEEKLSV-FVESEG-FSKEYKLPKEARLLVKDGD


                         *         .         .         .         .         +         .:1260
query           QVSRGDVLADGPTDPHDLLKYKGLEEFADYILIEAQSVYRMQGVVINDKHIETIVRQMLRKAVILDEGDS
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2o5jD           -------------DPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDS
2ppbD           ----------------------------------------------------------------------
1ynjD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------
1ynjJ           YVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVDEIQKVYRAQGVKLHDKHIEIVVRQMLKYVEVTDPGDS
2waqA           ----------------------------------------------------------------------
2pmzA           ----------------------------------------------------------------------
3hkzA           ----------------------------------------------------------------------
2e2hA           ----------------------------------------------------------------------
2nvxA           ----------------------------------------------------------------------
2yu9A           ----------------------------------------------------------------------
1y1vA           ----------------------------------------------------------------------
1wcmA           ----------------------------------------------------------------------
2vumA           ----------------------------------------------------------------------
2r92A           ----------------------------------------------------------------------
1r9tA           ----------------------------------------------------------------------
2nvtA           ----------------------------------------------------------------------
2nvqA           ----------------------------------------------------------------------
2ja5A           ----------------------------------------------------------------------
1i50A           ----------------------------------------------------------------------
3i4mA           ----------------------------------------------------------------------
1i3qA           ----------------------------------------------------------------------
3hozA           ----------------------------------------------------------------------
3hoyA           ----------------------------------------------------------------------
3hoxA           ----------------------------------------------------------------------
3houA           ----------------------------------------------------------------------
3gtjA           ----------------------------------------------------------------------
3gtgA           ----------------------------------------------------------------------
3fkiA           ----------------------------------------------------------------------
2e2iA           ----------------------------------------------------------------------
1nikA           ----------------------------------------------------------------------
1i6hA           ----------------------------------------------------------------------
1r5uA           ----------------------------------------------------------------------
1k83A           ----------------------------------------------------------------------
3h0gM           ----------------------------------------------------------------------
3h0gA           ----------------------------------------------------------------------
1twcA           ----------------------------------------------------------------------
1twgA           ----------------------------------------------------------------------
1twaA           ----------------------------------------------------------------------
3cqzA           ----------------------------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2pmzC           ----------------------------------------------------------------------
3hkzC           ----------------------------------------------------------------------
2waqC           ----------------------------------------------------------------------
2ghoD           YVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVDEIQKVYRAQGVKLHDKHIEIVVRQMLKYVEVTDPGDS
1l9uD           YVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVDEIQKVYRAQGVKLHDKHIEIVVRQMLKYVEVTDPGDS
1hqmD           YVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVDEIQKVYRAQGVKLHDKHIEIVVRQMLKYVEVTDPGDS
1i6vD           YVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVDEIQKVYRAQGVKLHDKHIEIVVRQMLKYVEVTDPGDS
1iw7D           YVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDS
3eqlD           YVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDS
3dxjD           YVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDS
2ppbD           YVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDS
2a6hD           YVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDS
1ddqD           YVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVDEIQKVYRAQGVKLHDKHIEIVVRQMLKYVEVTDPGDS
2o5iD           YVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDS


                         .         .         .         *         .         .         .:1330
query           KFVKDESIELVRILEENDKLRKQGKKEVEYELVLMGITRSSLSTESFLSAASFQETTRVLTEASINSQID
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2o5jD           RLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKD
2ppbD           ----------------------------------------------------------------------
1ynjD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------
1ynjJ           RLLEGQVLEKWDVEALNERLIAEGKVPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKD
2waqA           ----------------------------------------------------------------------
2pmzA           ----------------------------------------------------------------------
3hkzA           ----------------------------------------------------------------------
2e2hA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
2nvxA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
2yu9A           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
1y1vA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
1wcmA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
2vumA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
2r92A           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
1r9tA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
2nvtA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
2nvqA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
2ja5A           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
1i50A           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
3i4mA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
1i3qA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
3hozA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
3hoyA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
3hoxA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
3houA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
3gtjA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
3gtgA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
3fkiA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
2e2iA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
1nikA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
1i6hA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
1r5uA           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
1k83A           ---------------------------------LTSVTRHGFSNTGALMRCSFEETVEILFEAGASAELD
3h0gM           ---------------------------------LMAITRHGINRAETLMRCSFEETVEILMDAAASGEKD
3h0gA           ---------------------------------LMAITRHGINRAETLMRCSFEETVEILMDAAASGEKD
1twcA           ----------------------------------MALLVDVMTTQGGLTSVT---TVEILFEAGASAELD
1twgA           ----------------------------------MALLVDVMTTQGGLTSVT---TVEILFEAGASAELD
1twaA           ----------------------------------MALLVDVMTTQGGLTSVTFEETVEILFEAGASAELD
3cqzA           ---------------------------------------------------SFEETVEILFEAGASAELD
2aukE           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2pmzC           ---------------------------------------------SVLARAAFEVTVKHLLDAAARGDVE
3hkzC           ---------------------------------------------SVLARAAFEVTVKHLLDAAARGDVE
2waqC           ---------------------------------------------SVLARAAFEVTVKHLLDAAARGDVE
2ghoD           RLLEGQVLEKWDVEALNERLIAEGKVPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKD
1l9uD           RLLEGQVLEKWDVEALNERLI---AVPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKD
1hqmD           PLLEGQVLEKWDVEALNERLI---AVPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKD
1i6vD           RLLEGQVLEKWDVEALNERLI---AVPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKD
1iw7D           RLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKD
3eqlD           RLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKD
3dxjD           RLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKD
2ppbD           RLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKD
2a6hD           RLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKD
1ddqD           PLLEGQVLEKWDVEALNERLIAEGKVPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKD
2o5iD           RLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKD


                         .         +         .         .         .         .         *:1400
query           NLRGLKENVLIGRLIPTGTGLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ghoD           ----------------------------------------------------------------------
1l9uD           ----------------------------------------------------------------------
1hqmD           ----------------------------------------------------------------------
1i6vD           ----------------------------------------------------------------------
1iw7D           ----------------------------------------------------------------------
3eqlD           ----------------------------------------------------------------------
3dxjD           ----------------------------------------------------------------------
2o5jD           ELIGLKENVILGRLIPAGTG--------------------------------------------------
2ppbD           ----------------------------------------------------------------------
1ynjD           ----------------------------------------------------------------------
2a6hD           ----------------------------------------------------------------------
1ddqD           ----------------------------------------------------------------------
2o5iD           ----------------------------------------------------------------------
1ynjJ           ELIGLKENVILGRLIPAGTG--------------------------------------------------
2waqA           ----------------------------------------------------------------------
2pmzA           ----------------------------------------------------------------------
3hkzA           ----------------------------------------------------------------------
2e2hA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
2nvxA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
2yu9A           DCRGVSENVILGQMAPIGTG--------------------------------------------------
1y1vA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
1wcmA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
2vumA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
2r92A           DCRGVSENVILGQMAPIGTG--------------------------------------------------
1r9tA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
2nvtA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
2nvqA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
2ja5A           DCRGVSENVILGQMAPIGTG--------------------------------------------------
1i50A           DCRGVSENVILGQMAPIGTG--------------------------------------------------
3i4mA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
1i3qA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
3hozA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
3hoyA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
3hoxA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
3houA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
3gtjA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
3gtgA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
3fkiA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
2e2iA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
1nikA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
1i6hA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
1r5uA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
1k83A           DCRGVSENVILGQMAPIGTG--------------------------------------------------
3h0gM           DCKGISENIMLGQLAPMGTG--------------------------------------------------
3h0gA           DCKGISENIMLGQLAPMGTG--------------------------------------------------
1twcA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
1twgA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
1twaA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
3cqzA           DCRGVSENVILGQMAPIGTG--------------------------------------------------
2aukE           ----------------------------------------------------------------------
2aukC           ----------------------------------------------------------------------
2aukB           ----------------------------------------------------------------------
2aukA           ----------------------------------------------------------------------
2pmzC           EFKGVVENIIIGHPIKLGTGM-------------------------------------------------
3hkzC           EFKGVVENIIIGHPIKLGTGM-------------------------------------------------
2waqC           EFKGVVENIIIGHPIKLGTGM-------------------------------------------------
2ghoD           ELIGLKENVILGRLIPAGTG--------------------------------------------------
1l9uD           ELIGLKENVILGRLIPAGTG--------------------------------------------------
1hqmD           ELIGLKENVILGRLIPAGTG--------------------------------------------------
1i6vD           ELIGLKENVILGRLIPAGTG--------------------------------------------------
1iw7D           ELIGLKENVILGRLIPAGTG--------------------------------------------------
3eqlD           ELIGLKENVILGRLIPAGTG--------------------------------------------------
3dxjD           ELIGLKENVILGRLIPAGTG--------------------------------------------------
2ppbD           ELIGLKENVILGRLIPAGTG--------------------------------------------------
2a6hD           ELIGLKENVILGRLIPAGTG--------------------------------------------------
1ddqD           ELIGLKENVILGRLIPAGTG--------------------------------------------------
2o5iD           ELIGLKENVILGRLIPAGTG--------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           xxxxxxxxxxxxxxxxx
2ghoD           -----------------
1l9uD           -----------------
1hqmD           -----------------
1i6vD           -----------------
1iw7D           -----------------
3eqlD           -----------------
3dxjD           -----------------
2o5jD           -----------------
2ppbD           -----------------
1ynjD           -----------------
2a6hD           -----------------
1ddqD           -----------------
2o5iD           -----------------
1ynjJ           -----------------
2waqA           -----------------
2pmzA           -----------------
3hkzA           -----------------
2e2hA           -----------------
2nvxA           -----------------
2yu9A           -----------------
1y1vA           -----------------
1wcmA           -----------------
2vumA           -----------------
2r92A           -----------------
1r9tA           -----------------
2nvtA           -----------------
2nvqA           -----------------
2ja5A           -----------------
1i50A           -----------------
3i4mA           -----------------
1i3qA           -----------------
3hozA           -----------------
3hoyA           -----------------
3hoxA           -----------------
3houA           -----------------
3gtjA           -----------------
3gtgA           -----------------
3fkiA           -----------------
2e2iA           -----------------
1nikA           -----------------
1i6hA           -----------------
1r5uA           -----------------
1k83A           -----------------
3h0gM           -----------------
3h0gA           -----------------
1twcA           -----------------
1twgA           -----------------
1twaA           -----------------
3cqzA           -----------------
2aukE           -----------------
2aukC           -----------------
2aukB           -----------------
2aukA           -----------------
2pmzC           -----------------
3hkzC           -----------------
2waqC           -----------------
2ghoD           -----------------
1l9uD           -----------------
1hqmD           -----------------
1i6vD           -----------------
1iw7D           -----------------
3eqlD           -----------------
3dxjD           -----------------
2ppbD           -----------------
2a6hD           -----------------
1ddqD           -----------------
2o5iD           -----------------