[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:ACD30340.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1zemA.bssp"
#ERROR : Can't open dsspfile "2japC.bssp"
#ERROR : Can't open dsspfile "2japA.bssp"
#ERROR : Can't open dsspfile "1iolA.bssp"
#ERROR : Can't open dsspfile "1bhsA.bssp"
#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "2yz7A.bssp"
#ERROR : Can't open dsspfile "1fduD.bssp"
#ERROR : Can't open dsspfile "1ae1B.bssp"
#ERROR : Can't open dsspfile "1xr3B.bssp"
#ERROR : Can't open dsspfile "1x7hB.bssp"
#ERROR : Can't open dsspfile "1w4zB.bssp"
#ERROR : Can't open dsspfile "1w4zA.bssp"
#ERROR : Can't open dsspfile "2rh4B.bssp"
#ERROR : Can't open dsspfile "2rh4A.bssp"
#ERROR : Can't open dsspfile "1x7gB.bssp"
#ERROR : Can't open dsspfile "1x7gA.bssp"
#ERROR : Can't open dsspfile "2rhrB.bssp"
#ERROR : Can't open dsspfile "1fduA.bssp"
#ERROR : Can't open dsspfile "3csdB.bssp"
#ERROR : Can't open dsspfile "2bd0A.bssp"
#ERROR : Can't open dsspfile "1xg5C.bssp"
#ERROR : Can't open dsspfile "1xg5B.bssp"
#ERROR : Can't open dsspfile "1xg5A.bssp"
#ERROR : Can't open dsspfile "1fduC.bssp"
#ERROR : Can't open dsspfile "2rhrA.bssp"
#ERROR : Can't open dsspfile "1ae1A.bssp"
#ERROR : Can't open dsspfile "2ae2A.bssp"
#ERROR : Can't open dsspfile "1fduB.bssp"
#ERROR : Can't open dsspfile "2ztmA.bssp"
#ERROR : Can't open dsspfile "1qyxA.bssp"
#ERROR : Can't open dsspfile "1qyvA.bssp"
#ERROR : Can't open dsspfile "1iy8A.bssp"
#ERROR : Can't open dsspfile "2c07A.bssp"
#ERROR : Can't open dsspfile "2ae1A.bssp"
#ERROR : Can't open dsspfile "1jtvA.bssp"
#ERROR : Can't open dsspfile "3deyX.bssp"
#ERROR : Can't open dsspfile "1fdwA.bssp"
#ERROR : Can't open dsspfile "2ztlA.bssp"
#ERROR : Can't open dsspfile "2uvdA.bssp"
#ERROR : Can't open dsspfile "2ztmC.bssp"
#ERROR : Can't open dsspfile "2q2wD.bssp"
#ERROR : Can't open dsspfile "2q2vC.bssp"
#ERROR : Can't open dsspfile "1fdsA.bssp"
#ERROR : Can't open dsspfile "2ztmD.bssp"
#ERROR : Can't open dsspfile "1fdvB.bssp"
#ERROR : Can't open dsspfile "1xu9B.bssp"
#ERROR : Can't open dsspfile "1xu9A.bssp"
#ERROR : Can't open dsspfile "1xu7D.bssp"
#ERROR : Can't open dsspfile "1xu7B.bssp"
#ERROR : Can't open dsspfile "1xu7A.bssp"
#ERROR : Can't open dsspfile "2rbeD.bssp"
#ERROR : Can't open dsspfile "2rbeC.bssp"
#ERROR : Can't open dsspfile "2rbeB.bssp"
#ERROR : Can't open dsspfile "2rbeA.bssp"
#ERROR : Can't open dsspfile "2irwC.bssp"
#ERROR : Can't open dsspfile "2irwA.bssp"
#ERROR : Can't open dsspfile "2iltA.bssp"
#ERROR : Can't open dsspfile "3hfgA.bssp"
#ERROR : Can't open dsspfile "3ey4C.bssp"
#ERROR : Can't open dsspfile "3ey4A.bssp"
#ERROR : Can't open dsspfile "3d5qB.bssp"
#ERROR : Can't open dsspfile "3d4nB.bssp"
#ERROR : Can't open dsspfile "3ch6E.bssp"
#ERROR : Can't open dsspfile "3ch6D.bssp"
#ERROR : Can't open dsspfile "3ch6B.bssp"
#ERROR : Can't open dsspfile "3ch6A.bssp"
#ERROR : Can't open dsspfile "3bzuB.bssp"
#ERROR : Can't open dsspfile "3bzuA.bssp"
#ERROR : Can't open dsspfile "3byzA.bssp"
#ERROR : Can't open dsspfile "2belD.bssp"
#ERROR : Can't open dsspfile "2belB.bssp"
#ERROR : Can't open dsspfile "2belA.bssp"
#ERROR : Can't open dsspfile "3czrA.bssp"
#ERROR : Can't open dsspfile "2ztvD.bssp"
#ERROR : Can't open dsspfile "2ztvC.bssp"
#ERROR : Can't open dsspfile "3hfgB.bssp"
#ERROR : Can't open dsspfile "3d4nD.bssp"
#ERROR : Can't open dsspfile "2q2qG.bssp"
#ERROR : Can't open dsspfile "2ztmB.bssp"
#ERROR : Can't open dsspfile "1xu9C.bssp"
#ERROR : Can't open dsspfile "2q2qE.bssp"
#ERROR : Can't open dsspfile "1nffA.bssp"
#ERROR : Can't open dsspfile "3hfgC.bssp"
#ERROR : Can't open dsspfile "1gegE.bssp"
#ERROR : Can't open dsspfile "1gegA.bssp"
#ERROR : Can't open dsspfile "3d4nC.bssp"
#ERROR : Can't open dsspfile "3d4nA.bssp"
#ERROR : Can't open dsspfile "3d3eB.bssp"
#ERROR : Can't open dsspfile "3d3eA.bssp"
#ERROR : Can't open dsspfile "2ztvB.bssp"
#ERROR : Can't open dsspfile "1x1tA.bssp"
#ERROR : Can't open dsspfile "2q2qB.bssp"
#ERROR : Can't open dsspfile "2ztuD.bssp"
#ERROR : Can't open dsspfile "2ztuC.bssp"
#ERROR : Can't open dsspfile "2ztuB.bssp"
#ERROR : Can't open dsspfile "2ztuA.bssp"
#ERROR : Can't open dsspfile "2q2wC.bssp"
#ERROR : Can't open dsspfile "2q2vD.bssp"
#ERROR : Can't open dsspfile "2q2qF.bssp"
#ERROR : Can't open dsspfile "3hfgD.bssp"
#ERROR : Can't open dsspfile "2belC.bssp"
#ERROR : Can't open dsspfile "1xu9D.bssp"
#ERROR : Can't open dsspfile "2q2wA.bssp"
#ERROR : Can't open dsspfile "2q2vB.bssp"
#ERROR : Can't open dsspfile "2q2vA.bssp"
#ERROR : Can't open dsspfile "2q2qC.bssp"
#ERROR : Can't open dsspfile "2q2qA.bssp"
#ERROR : Can't open dsspfile "2p68B.bssp"
#ERROR : Can't open dsspfile "2p68A.bssp"
#ERROR : Can't open dsspfile "3frjA.bssp"
#ERROR : Can't open dsspfile "3d5qD.bssp"
#ERROR : Can't open dsspfile "2q2qH.bssp"
#ERROR : Can't open dsspfile "2ehdB.bssp"
#ERROR : Can't open dsspfile "3d5qC.bssp"
#ERROR : Can't open dsspfile "3d5qA.bssp"
#ERROR : Can't open dsspfile "3bzuD.bssp"
#ERROR : Can't open dsspfile "3bzuC.bssp"
#ERROR : Can't open dsspfile "2zk7B.bssp"
#ERROR : Can't open dsspfile "1uznB.bssp"
#ERROR : Can't open dsspfile "1uznA.bssp"
#ERROR : Can't open dsspfile "1q7bB.bssp"
#ERROR : Can't open dsspfile "1q7bA.bssp"
#ERROR : Can't open dsspfile "2ehdA.bssp"
#ERROR : Can't open dsspfile "2dteA.bssp"
#ERROR : Can't open dsspfile "3f9iA.bssp"
#ERROR : Can't open dsspfile "1q7cA.bssp"
#ERROR : Can't open dsspfile "3g1tA.bssp"
#ERROR : Can't open dsspfile "2cfcA.bssp"
#ERROR : Can't open dsspfile "2jahC.bssp"
#ERROR : Can't open dsspfile "2jahA.bssp"
#ERROR : Can't open dsspfile "3ezlA.bssp"
#ERROR : Can't open dsspfile "1y5mA.bssp"
#ERROR : Can't open dsspfile "2d1yB.bssp"
#ERROR : Can't open dsspfile "1nfrA.bssp"
#ERROR : Can't open dsspfile "1uzlB.bssp"
#ERROR : Can't open dsspfile "1i01E.bssp"
#ERROR : Can't open dsspfile "2et6A.bssp"
#ERROR : Can't open dsspfile "2d1yD.bssp"
#ERROR : Can't open dsspfile "2d1yC.bssp"
#ERROR : Can't open dsspfile "2d1yA.bssp"
#ERROR : Can't open dsspfile "3cxrA.bssp"
#ERROR : Can't open dsspfile "1i01B.bssp"
#ERROR : Can't open dsspfile "3gk3A.bssp"
#ERROR : Can't open dsspfile "3gk3C.bssp"
#ERROR : Can't open dsspfile "1cydA.bssp"
#ERROR : Can't open dsspfile "3cxtA.bssp"
#ERROR : Can't open dsspfile "1xseA.bssp"
#ERROR : Can't open dsspfile "1hdcA.bssp"
#ERROR : Can't open dsspfile "3g49A.bssp"
#ERROR : Can't open dsspfile "3dwfC.bssp"
#ERROR : Can't open dsspfile "3dwfB.bssp"
#ERROR : Can't open dsspfile "3dwfA.bssp"
#ERROR : Can't open dsspfile "3gk3B.bssp"
#ERROR : Can't open dsspfile "3gk3D.bssp"
#ERROR : Can't open dsspfile "1vl8B.bssp"
#ERROR : Can't open dsspfile "1vl8A.bssp"
#ERROR : Can't open dsspfile "1k2wA.bssp"
#ERROR : Can't open dsspfile "2b4qA.bssp"
#ERROR : Can't open dsspfile "1spxA.bssp"
#ERROR : Can't open dsspfile "1zbqA.bssp"
#ERROR : Can't open dsspfile "2ph3A.bssp"
#ERROR : Can't open dsspfile "3gz4B.bssp"
#ERROR : Can't open dsspfile "3gz4A.bssp"
#ERROR : Can't open dsspfile "1g6kA.bssp"
#ERROR : Can't open dsspfile "3ftpD.bssp"
#ERROR : Can't open dsspfile "3i3oG.bssp"
#ERROR : Can't open dsspfile "3i3oF.bssp"
#ERROR : Can't open dsspfile "3i3oE.bssp"
#ERROR : Can't open dsspfile "3i3oC.bssp"
#ERROR : Can't open dsspfile "3i3oB.bssp"
#ERROR : Can't open dsspfile "3i3oA.bssp"
#ERROR : Can't open dsspfile "1geeA.bssp"
#ERROR : Can't open dsspfile "1gcoA.bssp"
#ERROR : Can't open dsspfile "1xhlA.bssp"
#ERROR : Can't open dsspfile "3f5qA.bssp"
#ERROR : Can't open dsspfile "1xkqB.bssp"
#ERROR : Can't open dsspfile "1xkqA.bssp"
#ERROR : Can't open dsspfile "3ijrH.bssp"
#ERROR : Can't open dsspfile "3ijrF.bssp"
#ERROR : Can't open dsspfile "3ijrE.bssp"
#ERROR : Can't open dsspfile "3ijrB.bssp"
#ERROR : Can't open dsspfile "3ijrA.bssp"
#ERROR : Can't open dsspfile "3i3oH.bssp"
#ERROR : Can't open dsspfile "3gafH.bssp"
#ERROR : Can't open dsspfile "3gafG.bssp"
#ERROR : Can't open dsspfile "3gafF.bssp"
#ERROR : Can't open dsspfile "3gafE.bssp"
#ERROR : Can't open dsspfile "3gafD.bssp"
#ERROR : Can't open dsspfile "3gafC.bssp"
#ERROR : Can't open dsspfile "3gafB.bssp"
#ERROR : Can't open dsspfile "3gafA.bssp"
#ERROR : Can't open dsspfile "3f9iB.bssp"
#ERROR : Can't open dsspfile "1zjyA.bssp"
#ERROR : Can't open dsspfile "1rwbA.bssp"
#ERROR : Can't open dsspfile "1nxqA.bssp"
#ERROR : Can't open dsspfile "1i01A.bssp"
#ERROR : Can't open dsspfile "3f5qB.bssp"
#ERROR : Can't open dsspfile "2ag5C.bssp"
#ERROR : Can't open dsspfile "2ag5B.bssp"
#ERROR : Can't open dsspfile "2ag5A.bssp"
#ERROR : Can't open dsspfile "1fmcA.bssp"
#ERROR : Can't open dsspfile "1ahhA.bssp"
#ERROR : Can't open dsspfile "1yb1A.bssp"
#ERROR : Can't open dsspfile "3i4fD.bssp"
#ERROR : Can't open dsspfile "3i4fC.bssp"
#ERROR : Can't open dsspfile "3i4fA.bssp"
#ERROR : Can't open dsspfile "2zatA.bssp"
#ERROR : Can't open dsspfile "1yb1B.bssp"
#ERROR : Can't open dsspfile "1n5dA.bssp"
#ERROR : Can't open dsspfile "3ftpC.bssp"
#ERROR : Can't open dsspfile "3f1lB.bssp"
#ERROR : Can't open dsspfile "3f1lA.bssp"
#ERROR : Can't open dsspfile "2zk7A.bssp"
#ERROR : Can't open dsspfile "3gy0A.bssp"
#ERROR : Can't open dsspfile "3guyG.bssp"
#ERROR : Can't open dsspfile "1wmaA.bssp"
#ERROR : Can't open dsspfile "1o5iA.bssp"
#ERROR : Can't open dsspfile "1i01F.bssp"
#ERROR : Can't open dsspfile "3guyD.bssp"
#ERROR : Can't open dsspfile "3bhmA.bssp"
#ERROR : Can't open dsspfile "3ftpA.bssp"
#ERROR : Can't open dsspfile "1edoA.bssp"
#ERROR : Can't open dsspfile "2pfgA.bssp"
#ERROR : Can't open dsspfile "2hq1A.bssp"
#ERROR : Can't open dsspfile "3gvcD.bssp"
#ERROR : Can't open dsspfile "3gvcC.bssp"
#ERROR : Can't open dsspfile "3gvcB.bssp"
#ERROR : Can't open dsspfile "3gvcA.bssp"
#ERROR : Can't open dsspfile "3emkB.bssp"
#ERROR : Can't open dsspfile "1gz6A.bssp"
#ERROR : Can't open dsspfile "3f5sB.bssp"
#ERROR : Can't open dsspfile "3f5sA.bssp"
#ERROR : Can't open dsspfile "2b4qB.bssp"
#ERROR : Can't open dsspfile "1ybvA.bssp"
#ERROR : Can't open dsspfile "2ph3B.bssp"
#ERROR : Can't open dsspfile "1i01D.bssp"
#ERROR : Can't open dsspfile "1g0oC.bssp"
#ERROR : Can't open dsspfile "1g0oA.bssp"
#ERROR : Can't open dsspfile "1g0nB.bssp"
#ERROR : Can't open dsspfile "1dohB.bssp"
#ERROR : Can't open dsspfile "1dohA.bssp"
#ERROR : Can't open dsspfile "2pd6D.bssp"
#ERROR : Can't open dsspfile "1xq1A.bssp"
#ERROR : Can't open dsspfile "2pd6C.bssp"
#ERROR : Can't open dsspfile "2gdzA.bssp"
#ERROR : Can't open dsspfile "2pd3A.bssp"
#ERROR : Can't open dsspfile "1i01C.bssp"
#ERROR : Can't open dsspfile "1gz6C.bssp"
#ERROR : Can't open dsspfile "1gz6B.bssp"
#ERROR : Can't open dsspfile "1i01H.bssp"
#ERROR : Can't open dsspfile "1i01G.bssp"
#ERROR : Can't open dsspfile "3guyH.bssp"
#ERROR : Can't open dsspfile "3guyC.bssp"
#ERROR : Can't open dsspfile "2fwmX.bssp"
#ERROR : Can't open dsspfile "2bgkA.bssp"
#ERROR : Can't open dsspfile "2pd6B.bssp"
#ERROR : Can't open dsspfile "3ennA.bssp"
#ERROR : Can't open dsspfile "2pd6A.bssp"
#ERROR : Can't open dsspfile "3guyA.bssp"
#ERROR : Can't open dsspfile "2ewmB.bssp"
#ERROR : Can't open dsspfile "2ewmA.bssp"
#ERROR : Can't open dsspfile "2ew8B.bssp"
#ERROR : Can't open dsspfile "2ew8A.bssp"
#ERROR : Can't open dsspfile "3emkA.bssp"
#ERROR : Can't open dsspfile "3bmeB.bssp"
#ERROR : Can't open dsspfile "3emkD.bssp"
#ERROR : Can't open dsspfile "3bmjD.bssp"
#ERROR : Can't open dsspfile "1yxmD.bssp"
#ERROR : Can't open dsspfile "1ulsC.bssp"
#ERROR : Can't open dsspfile "3guyB.bssp"
#ERROR : Can't open dsspfile "3ennB.bssp"
#ERROR : Can't open dsspfile "2wd7B.bssp"
#ERROR : Can't open dsspfile "3bmnC.bssp"
#ERROR : Can't open dsspfile "3bmeA.bssp"
#ERROR : Can't open dsspfile "2vz0B.bssp"
#ERROR : Can't open dsspfile "1ulsB.bssp"
#ERROR : Can't open dsspfile "1ulsA.bssp"
#ERROR : Can't open dsspfile "3grkG.bssp"
#ERROR : Can't open dsspfile "3bmfD.bssp"
#ERROR : Can't open dsspfile "3bmdB.bssp"
#ERROR : Can't open dsspfile "1yxmB.bssp"
#ERROR : Can't open dsspfile "2wd7C.bssp"
#ERROR : Can't open dsspfile "3bmoD.bssp"
#ERROR : Can't open dsspfile "3bmoC.bssp"
#ERROR : Can't open dsspfile "1yxmA.bssp"
#ERROR : Can't open dsspfile "2vz0A.bssp"
#ERROR : Can't open dsspfile "3iahA.bssp"
#ERROR : Can't open dsspfile "3ennD.bssp"
#ERROR : Can't open dsspfile "3ennC.bssp"
#ERROR : Can't open dsspfile "3emkC.bssp"
#ERROR : Can't open dsspfile "2c7vB.bssp"
#ERROR : Can't open dsspfile "2c7vA.bssp"
#ERROR : Can't open dsspfile "3bmfA.bssp"
#ERROR : Can't open dsspfile "2c7vD.bssp"
#ERROR : Can't open dsspfile "3bmqA.bssp"
#ERROR : Can't open dsspfile "3bmkC.bssp"
#ERROR : Can't open dsspfile "2yw9H.bssp"
#ERROR : Can't open dsspfile "3iccA.bssp"
#ERROR : Can't open dsspfile "3bmqC.bssp"
#ERROR : Can't open dsspfile "3bmnD.bssp"
#ERROR : Can't open dsspfile "3grkA.bssp"
#ERROR : Can't open dsspfile "3bmeC.bssp"
#ERROR : Can't open dsspfile "1fk8A.bssp"
#ERROR : Can't open dsspfile "1fjhA.bssp"
#ERROR : Can't open dsspfile "3bmoB.bssp"
#ERROR : Can't open dsspfile "3bmnA.bssp"
#ERROR : Can't open dsspfile "3bmiB.bssp"
#ERROR : Can't open dsspfile "3bmfC.bssp"
#ERROR : Can't open dsspfile "3bmfB.bssp"
#ERROR : Can't open dsspfile "3grkB.bssp"
#ERROR : Can't open dsspfile "3e9nC.bssp"
#ERROR : Can't open dsspfile "3e9nA.bssp"
#ERROR : Can't open dsspfile "3bmnB.bssp"
#ERROR : Can't open dsspfile "3k2eB.bssp"
#ERROR : Can't open dsspfile "3grpA.bssp"
#ERROR : Can't open dsspfile "3grkD.bssp"
#ERROR : Can't open dsspfile "3f1kA.bssp"
#ERROR : Can't open dsspfile "1a4uA.bssp"
#ERROR : Can't open dsspfile "3grpD.bssp"
#ERROR : Can't open dsspfile "3grpB.bssp"
#ERROR : Can't open dsspfile "2z1nB.bssp"
#ERROR : Can't open dsspfile "2z1nA.bssp"

## Summary of PDB Search
:274
    8e-17  31%  1zemA  [x.x.x] XYLITOL DEHYDROGENASE
    8e-17  30%  2japC  [x.x.x] CLAVALDEHYDE DEHYDROGENASE
    8e-17  30%  2japA  [x.x.x] CLAVALDEHYDE DEHYDROGENASE
    8e-17  29%  1iolA  [x.x.x] ESTROGENIC 17-BETA HYDROXYSTEROID DEHYDROGENASE
    2e-16  29%  1bhsA  [c.2.1 (1dhtA)] 17BETA-HYDROXYSTEROID DEHYDROGENASE
    2e-16  29%  1a27A  [c.2.1 (1i5rA)] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    7e-16  32%  2yz7A  [x.x.x] D-3-HYDROXYBUTYRATE DEHYDROGENASE
    9e-16  26%  1fduD  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    1e-15  31%  1ae1B  [c.2.1] TROPINONE REDUCTASE-I
    1e-15  32%  1xr3B  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    1e-15  31%  1x7hB  [c.2.1] PUTATIVE KETOACYL REDUCTASE
    1e-15  31%  1w4zB  [c.2.1] KETOACYL REDUCTASE
    1e-15  31%  1w4zA  [c.2.1] KETOACYL REDUCTASE
    1e-15  31%  2rh4B  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    1e-15  31%  2rh4A  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    2e-15  32%  1x7gB  [c.2.1] PUTATIVE KETOACYL REDUCTASE
    2e-15  32%  1x7gA  [c.2.1] PUTATIVE KETOACYL REDUCTASE
    2e-15  31%  2rhrB  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    2e-15  26%  1fduA  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    2e-15  31%  3csdB  [x.x.x] PUTATIVE KETOACYL REDUCTASE
    2e-15  34%  2bd0A  [x.x.x] SEPIAPTERIN REDUCTASE
    3e-15  35%  1xg5C  [c.2.1] ARPG836
    3e-15  35%  1xg5B  [c.2.1] ARPG836
    3e-15  35%  1xg5A  [c.2.1] ARPG836
    3e-15  28%  1fduC  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    3e-15  32%  2rhrA  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    7e-15  31%  1ae1A  [c.2.1] TROPINONE REDUCTASE-I
    1e-14  28%  2ae2A  [c.2.1] PROTEIN (TROPINONE REDUCTASE-II)
    1e-14  28%  1fduB  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    4e-14  32%  2ztmA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    4e-14  29%  1qyxA  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 1
    4e-14  29%  1qyvA  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 1
    4e-14  30%  1iy8A  [c.2.1] LEVODIONE REDUCTASE
    4e-14  29%  2c07A  [x.x.x] 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE
    4e-14  28%  2ae1A  [x.x.x] TROPINONE REDUCTASE-II
    5e-14  29%  1jtvA  [c.2.1] 17 BETA-HYDROXYSTEROID DEHYDROGENASE TYPE 1
    5e-14  29%  3deyX  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 1
    6e-14  29%  1fdwA  [x.x.x] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    8e-14  31%  2ztlA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    8e-14  30%  2uvdA  [x.x.x] 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
    1e-13  32%  2ztmC  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    1e-13  26%  2q2wD  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-13  26%  2q2vC  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-13  28%  1fdsA  [x.x.x] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    2e-13  33%  2ztmD  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    2e-13  28%  1fdvB  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    2e-13  30%  1xu9B  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    2e-13  30%  1xu9A  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    2e-13  30%  1xu7D  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    2e-13  30%  1xu7B  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    2e-13  30%  1xu7A  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    2e-13  30%  2rbeD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  2rbeC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  2rbeB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  2rbeA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  2irwC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  2irwA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  2iltA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  3hfgA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  3ey4C  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    2e-13  30%  3ey4A  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    2e-13  30%  3d5qB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  3d4nB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  3ch6E  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  3ch6D  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  3ch6B  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  3ch6A  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  3bzuB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  3bzuA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  3byzA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  2belD  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  2belB  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-13  30%  2belA  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-13  31%  3czrA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-13  32%  2ztvD  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    4e-13  32%  2ztvC  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    4e-13  30%  3hfgB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-13  30%  3d4nD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    5e-13  27%  2q2qG  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    7e-13  33%  2ztmB  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    7e-13  31%  1xu9C  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    7e-13  28%  2q2qE  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    7e-13  32%  1nffA  [c.2.1] PUTATIVE OXIDOREDUCTASE RV2002
    7e-13  31%  3hfgC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    7e-13  30%  1gegE  [c.2.1] ACETOIN REDUCTASE
    7e-13  30%  1gegA  [c.2.1] ACETOIN REDUCTASE
    7e-13  31%  3d4nC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    7e-13  31%  3d4nA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    7e-13  31%  3d3eB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    7e-13  31%  3d3eA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    9e-13  32%  2ztvB  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    9e-13  32%  1x1tA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    9e-13  27%  2q2qB  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-12  34%  2ztuD  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    1e-12  34%  2ztuC  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    1e-12  34%  2ztuB  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    1e-12  34%  2ztuA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    1e-12  27%  2q2wC  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-12  26%  2q2vD  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-12  27%  2q2qF  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-12  31%  3hfgD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-12  31%  2belC  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-12  31%  1xu9D  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    2e-12  28%  2q2wA  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    2e-12  28%  2q2vB  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    2e-12  28%  2q2vA  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    2e-12  28%  2q2qC  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    2e-12  28%  2q2qA  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    2e-12  27%  2p68B  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-12  27%  2p68A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-12  31%  3frjA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    2e-12  31%  3d5qD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-12  29%  2q2qH  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    2e-12  29%  2ehdB  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    2e-12  30%  3d5qC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-12  30%  3d5qA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-12  31%  3bzuD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-12  30%  3bzuC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    6e-12  30%  2zk7B  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    6e-12  28%  1uznB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    6e-12  28%  1uznA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    6e-12  27%  1q7bB  [c.2.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    6e-12  27%  1q7bA  [c.2.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    6e-12  29%  2ehdA  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    6e-12  30%  2dteA  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    1e-11  33%  3f9iA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-11  26%  1q7cA  [c.2.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    2e-11  27%  3g1tA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-11  31%  2cfcA  [x.x.x] 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE
    2e-11  31%  2jahC  [x.x.x] CLAVULANIC ACID DEHYDROGENASE
    2e-11  31%  2jahA  [x.x.x] CLAVULANIC ACID DEHYDROGENASE
    2e-11  29%  3ezlA  [x.x.x] ACETOACETYL-COA REDUCTASE
    4e-11  29%  1y5mA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE, ISOZYME 1
    4e-11  31%  2d1yB  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    5e-11  30%  1nfrA  [c.2.1] PUTATIVE OXIDOREDUCTASE RV2002
    8e-11  28%  1uzlB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    8e-11  28%  1i01E  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    8e-11  27%  2et6A  [x.x.x] (3R)-HYDROXYACYL-COA DEHYDROGENASE
    8e-11  31%  2d1yD  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    1e-10  32%  2d1yC  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    1e-10  32%  2d1yA  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    1e-10  28%  3cxrA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    1e-10  28%  1i01B  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    1e-10  25%  3gk3A  [x.x.x] ACETOACETYL-COA REDUCTASE
    2e-10  25%  3gk3C  [x.x.x] ACETOACETYL-COA REDUCTASE
    2e-10  28%  1cydA  [c.2.1] CARBONYL REDUCTASE
    2e-10  27%  3cxtA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    4e-10  30%  1xseA  [c.2.1] 11BETA-HYDROXYSTEROID DEHYDROGENASE TYPE 1
    4e-10  27%  1hdcA  [c.2.1] 3-ALPHA, 20 BETA-HYDROXYSTEROID DEHYDROGENASE
    4e-10  30%  3g49A  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    4e-10  30%  3dwfC  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    4e-10  30%  3dwfB  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    4e-10  30%  3dwfA  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    5e-10  24%  3gk3B  [x.x.x] ACETOACETYL-COA REDUCTASE
    7e-10  25%  3gk3D  [x.x.x] ACETOACETYL-COA REDUCTASE
    2e-09  27%  1vl8B  [c.2.1] GLUCONATE 5-DEHYDROGENASE
    2e-09  27%  1vl8A  [c.2.1] GLUCONATE 5-DEHYDROGENASE
    2e-09  29%  1k2wA  [c.2.1] SORBITOL DEHYDROGENASE
    2e-09  32%  2b4qA  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    3e-09  32%  1spxA  [c.2.1] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5L265)
    3e-09  30%  1zbqA  [x.x.x] 17-BETA-HYDROXYSTEROID DEHYDROGENASE 4
    3e-09  27%  2ph3A  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    3e-09  26%  3gz4B  [x.x.x] HYPOTHETICAL OXIDOREDUCTASE YCIK
    3e-09  26%  3gz4A  [x.x.x] HYPOTHETICAL OXIDOREDUCTASE YCIK
    3e-09  27%  1g6kA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    5e-09  26%  3ftpD  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    6e-09  30%  3i3oG  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-09  28%  3i3oF  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-09  28%  3i3oE  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-09  28%  3i3oC  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-09  28%  3i3oB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-09  28%  3i3oA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-09  27%  1geeA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    6e-09  27%  1gcoA  [c.2.1] GLUCOSE DEHYDROGENASE
    8e-09  27%  1xhlA  [c.2.1] SHORT-CHAIN DEHYDROGENASE/REDUCTASE FAMILY
    8e-09  26%  3f5qA  [x.x.x] DEHYGROGENASE
    1e-08  29%  1xkqB  [c.2.1] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5D234)
    1e-08  29%  1xkqA  [c.2.1] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5D234)
    1e-08  30%  3ijrH  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    1e-08  30%  3ijrF  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    1e-08  30%  3ijrE  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    1e-08  30%  3ijrB  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    1e-08  30%  3ijrA  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    1e-08  30%  3i3oH  [x.x.x] SHORT CHAIN DEHYDROGENASE
    1e-08  29%  3gafH  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-08  29%  3gafG  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-08  29%  3gafF  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-08  29%  3gafE  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-08  29%  3gafD  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-08  29%  3gafC  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-08  29%  3gafB  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-08  29%  3gafA  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-08  31%  3f9iB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    1e-08  30%  1zjyA  [x.x.x] R-SPECIFIC ALCOHOL DEHYDROGENASE
    1e-08  27%  1rwbA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    1e-08  30%  1nxqA  [c.2.1] R-ALCOHOL DEHYDROGENASE
    1e-08  30%  1i01A  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    2e-08  27%  3f5qB  [x.x.x] DEHYGROGENASE
    2e-08  27%  2ag5C  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    2e-08  27%  2ag5B  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    2e-08  27%  2ag5A  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    2e-08  28%  1fmcA  [c.2.1] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-08  28%  1ahhA  [c.2.1] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    3e-08  25%  1yb1A  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE XI
    3e-08  29%  3i4fD  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    3e-08  29%  3i4fC  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    3e-08  29%  3i4fA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    4e-08  28%  2zatA  [x.x.x] DEHYDROGENASE/REDUCTASE SDR FAMILY MEMBER 4
    4e-08  25%  1yb1B  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE XI
    4e-08  31%  1n5dA  [c.2.1] CARBONYL REDUCTASE/20BETA-HYDROXYSTEROID
    4e-08  26%  3ftpC  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    5e-08  25%  3f1lB  [x.x.x] UNCHARACTERIZED OXIDOREDUCTASE YCIK
    5e-08  25%  3f1lA  [x.x.x] UNCHARACTERIZED OXIDOREDUCTASE YCIK
    7e-08  33%  2zk7A  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    7e-08  26%  3gy0A  [x.x.x] DEHYDROGENASE
    7e-08  24%  3guyG  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    9e-08  32%  1wmaA  [x.x.x] CARBONYL REDUCTASE [NADPH] 1
    9e-08  24%  1o5iA  [c.2.1] 3-OXOACYL-(ACYL CARRIER PROTEIN) REDUCTASE
    9e-08  28%  1i01F  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    9e-08  24%  3guyD  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    9e-08  32%  3bhmA  [x.x.x] CARBONYL REDUCTASE [NADPH] 1
    1e-07  26%  3ftpA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    1e-07  28%  1edoA  [c.2.1] BETA-KETO ACYL CARRIER PROTEIN REDUCTASE
    3e-07  33%  2pfgA  [x.x.x] CARBONYL REDUCTASE [NADPH] 1
    3e-07  33%  2hq1A  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    3e-07  32%  3gvcD  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    3e-07  32%  3gvcC  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    3e-07  32%  3gvcB  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    3e-07  32%  3gvcA  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    3e-07  23%  3emkB  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    3e-07  28%  1gz6A  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 4
    3e-07  26%  3f5sB  [x.x.x] DEHYDROGENASE
    3e-07  26%  3f5sA  [x.x.x] DEHYDROGENASE
    3e-07  32%  2b4qB  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    4e-07  27%  1ybvA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    4e-07  27%  2ph3B  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    4e-07  26%  1i01D  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    4e-07  27%  1g0oC  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    4e-07  27%  1g0oA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    4e-07  27%  1g0nB  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    4e-07  27%  1dohB  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    4e-07  27%  1dohA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    7e-07  29%  2pd6D  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 8
    1e-06  30%  1xq1A  [c.2.1] PUTATIVE TROPINONE REDUCATSE
    1e-06  30%  2pd6C  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 8
    1e-06  32%  2gdzA  [x.x.x] NAD+-DEPENDENT 15-HYDROXYPROSTAGLANDIN
    1e-06  27%  2pd3A  [c.2.1 (1jvfA)] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-06  27%  1i01C  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    2e-06  28%  1gz6C  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 4
    2e-06  28%  1gz6B  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 4
    2e-06  28%  1i01H  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    2e-06  28%  1i01G  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    2e-06  24%  3guyH  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    2e-06  24%  3guyC  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    4e-06  27%  2fwmX  [x.x.x] 2,3-DIHYDRO-2,3-DIHYDROXYBENZOATE DEHYDROGENASE
    4e-06  27%  2bgkA  [x.x.x] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
    5e-06  29%  2pd6B  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 8
    6e-06  22%  3ennA  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    8e-06  29%  2pd6A  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 8
    1e-05  24%  3guyA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    1e-05  27%  2ewmB  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    1e-05  27%  2ewmA  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    1e-05  27%  2ew8B  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    1e-05  27%  2ew8A  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    1e-05  21%  3emkA  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    1e-05  26%  3bmeB  [x.x.x] PTERIDINE REDUCTASE
    2e-05  22%  3emkD  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    2e-05  27%  3bmjD  [x.x.x] PTERIDINE REDUCTASE
    2e-05  27%  1yxmD  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    2e-05  31%  1ulsC  [c.2.1] PUTATIVE 3-OXOACYL-ACYL CARRIER PROTEIN
    2e-05  23%  3guyB  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    2e-05  22%  3ennB  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    3e-05  27%  2wd7B  [x.x.x] PTERIDINE REDUCTASE
    3e-05  26%  3bmnC  [x.x.x] PTERIDINE REDUCTASE
    3e-05  28%  3bmeA  [x.x.x] PTERIDINE REDUCTASE
    4e-05  27%  2vz0B  [x.x.x] PTERIDINE REDUCTASE
    4e-05  31%  1ulsB  [c.2.1] PUTATIVE 3-OXOACYL-ACYL CARRIER PROTEIN
    4e-05  31%  1ulsA  [c.2.1] PUTATIVE 3-OXOACYL-ACYL CARRIER PROTEIN
    4e-05  30%  3grkG  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    4e-05  28%  3bmfD  [x.x.x] PTERIDINE REDUCTASE
    4e-05  27%  3bmdB  [x.x.x] PTERIDINE REDUCTASE
    5e-05  28%  1yxmB  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    5e-05  27%  2wd7C  [x.x.x] PTERIDINE REDUCTASE
    5e-05  26%  3bmoD  [x.x.x] PTERIDINE REDUCTASE
    5e-05  26%  3bmoC  [x.x.x] PTERIDINE REDUCTASE
    7e-05  27%  1yxmA  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    7e-05  27%  2vz0A  [x.x.x] PTERIDINE REDUCTASE
    7e-05  28%  3iahA  [x.x.x] SHORT CHAIN DEHYDROGENASE YCIK
    7e-05  22%  3ennD  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    7e-05  22%  3ennC  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    7e-05  22%  3emkC  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    7e-05  26%  2c7vB  [x.x.x] PTERIDINE REDUCTASE
    7e-05  26%  2c7vA  [x.x.x] PTERIDINE REDUCTASE
    7e-05  27%  3bmfA  [x.x.x] PTERIDINE REDUCTASE
    9e-05  27%  2c7vD  [x.x.x] PTERIDINE REDUCTASE
    9e-05  26%  3bmqA  [x.x.x] PTERIDINE REDUCTASE
    1e-04  27%  3bmkC  [x.x.x] PTERIDINE REDUCTASE
    2e-04  25%  2yw9H  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    2e-04  31%  3iccA  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL CARRIER PROTEIN)
    2e-04  27%  3bmqC  [x.x.x] PTERIDINE REDUCTASE
    2e-04  26%  3bmnD  [x.x.x] PTERIDINE REDUCTASE
    2e-04  31%  3grkA  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    2e-04  28%  3bmeC  [x.x.x] PTERIDINE REDUCTASE
    3e-04  34%  1fk8A  [c.2.1] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL
    3e-04  34%  1fjhA  [c.2.1] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL
    3e-04  28%  3bmoB  [x.x.x] PTERIDINE REDUCTASE
    3e-04  27%  3bmnA  [x.x.x] PTERIDINE REDUCTASE
    3e-04  27%  3bmiB  [x.x.x] PTERIDINE REDUCTASE
    3e-04  28%  3bmfC  [x.x.x] PTERIDINE REDUCTASE
    3e-04  28%  3bmfB  [x.x.x] PTERIDINE REDUCTASE
    3e-04  28%  3grkB  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    3e-04  29%  3e9nC  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    3e-04  29%  3e9nA  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    3e-04  27%  3bmnB  [x.x.x] PTERIDINE REDUCTASE
    4e-04  30%  3k2eB  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
    4e-04  26%  3grpA  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    4e-04  30%  3grkD  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    4e-04  28%  3f1kA  [x.x.x] UNCHARACTERIZED OXIDOREDUCTASE YCIK
    6e-04  28%  1a4uA  [c.2.1] ALCOHOL DEHYDROGENASE
    8e-04  28%  3grpD  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    8e-04  27%  3grpB  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    0.001  18%  2z1nB  [x.x.x] DEHYDROGENASE
    0.001  18%  2z1nA  [x.x.x] DEHYDROGENASE
:274

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xVNNSKTILITGCSHGGIGYATAVHLKNLGHRVFASARQQKDVEALSQEGFETYLIDVTNYEYIDNALAD
1zemA           ---NGKVCLVTGAG-GNIGLATALRLAEEGTAIALLDMNREALESVREKGVESYVCDVTSEEAVIGTVDS
2japC           -------------------------------------------------------LDVADRQGVDAAVAS
2japA           -------------------------------------------------------LDVADRQGVDAAVAS
1iolA           -------VLITGCS-SGIGLHLAVRLASQSFKVYATLRDLKTQGRLWEAALETLQLDVRDSKSVAAARER
1bhsA           -------VLITGCS-SGIGLHLAVRLASQSFKVYATLRDLKTQGRLWEAALETLQLDVRDSKSVAAARER
1a27A           -------VLITGCS-SGIGLHLAVRLASQSFKVYATLRDLKTQGRLWEAALETLQLDVRDSKSVAAARER
2yz7A           -----KKAVVTG-STSGIGLAMATELAKAGADVVINGGQPEDIERESKFGVKAYYLDLSDAQATRDFIAK
1fduD           -------VLITGCS-SGIGLHLAVRLASQSFKVYATLRDLKTQGRLWEAALETLQLDVRDSKSVAAARER
1ae1B           ------TALVTGGSKG-IGYAIVEELAGLGARVYTCSRNEKELDGLNVEGSVCDLLSRTERDKLMQTVAH
1xr3B           ---DSEVALVTGAT-SGIGLEIARRLGKEGLRVFVCARGEEGLRTLREAGVEARTCDVRSVPEIEALVAA
1x7hB           ---DSEVALVTGAT-SGIGLEIARRLGKEGLRVFVCARGEEGLRTLREAGVEARTCDVRSVPEIEALVAA
1w4zB           ---DSEVALVTGAT-SGIGLEIARRLGKEGLRVFVCARGEEGLRTLREAGVEARTCDVRSVPEIEALVAA
1w4zA           ---DSEVALVTGAT-SGIGLEIARRLGKEGLRVFVCARGEEGLRTLREAGVEARTCDVRSVPEIEALVAA
2rh4B           ---DSEVALVTGAT-SGIGLEIARRLGKEGLRVFVCARGEEGLRTLREAGVEARTCDVRSVPEIEALVAA
2rh4A           ---DSEVALVTGAT-SGIGLEIARRLGKEGLRVFVCARGEEGLRTLREAGVEARTCDVRSVPEIEALVAA
1x7gB           ---DSEVALVTGAT-SGIGLEIARRLGKEGLRVFVCARGEEGLRTLREAGVEARTCDVRSVPEIEALVAA
1x7gA           ----SEVALVTGAT-SGIGLEIARRLGKEGLRVFVCARGEEGLRTLREAGVEARTCDVRSVPEIEALVAA
2rhrB           ---DSEVALVTGAT-SGIGLEIARRLGKEGLRVFVCARGEEGLRTLREAGVEARTCDVRSVPEIEALVAA
1fduA           -------VLITGCS-SGIGLHLAVRLASQSFKVYATLRDLKTQGRLWEAALETLQLDVRDSKSVAAARER
3csdB           ---DSEVALVTGAT-SGIGLEIARRLGKEGLRVFVCARGEEGLRTLREAGVEARTCDVRSVPEIEALVAA
2bd0A           -------LLITGAGKG-IGRAIALEFARAARHLVLSSRTAADLEKISLERAEGALTDTITADISD--MAD
1xg5C           --------LVTGAS-GGIGAAVARALVQQGLKVVGCARTVGNIEELAAEGYPGTLIDLSNEEDILSMFSA
1xg5B           --------LVTGAS-GGIGAAVARALVQQGLKVVGCARTVGNIEELAAEGYPGTLIDLSNEEDILSMFSA
1xg5A           --------LVTGAS-GGIGAAVARALVQQGLKVVGCARTVGNIEELAAEGYPGTLIDLSNEEDILSMFSA
1fduC           -------VLITGCS-SGIGLHLAVRLASQSFKVYATLRDLKTQGRLWEAALETLQLDVRDSKSVAAARER
2rhrA           ----SEVALVTGAT-SGIGLEIARRLGKEGLRVFVCARGEEGLRTLREAGVEARTCDVRSVPEIEALVAA
1ae1A           ------TALVTGGSKG-IGYAIVEELAGLGARVYTCSRNEKELDGLNVEGSVCDLLSRTERDKLMQTVAH
2ae2A           ------TALVTGGSRG-IGYGIVEELASLGASVYTCSRNQKELDCLTQKGFEASVCDLSSRSERQELMNT
1fduB           -------VLITGCS-SGIGLHLAVRLASQSFKVYATLRDLKTQGRLWEAALETLQLDVRDSKSVAAARER
2ztmA           ---------------------------------------------------------------VDNAVRQ
1qyxA           -------VLITGCS-SGIGLHLAVRLASQSFKVYATLRDLKTQGRLWEAALETLQLDVRDSKSVAAARER
1qyvA           -------VLITGCS-SGIGLHLAVRLASQSFKVYATLRDLKTQGRLWEAALETLQLDVRDSKSVAAARER
1iy8A           -----RVVLITG-GGSGLGRATAVRLAAEGAKLSLVDVSSEGLEASKAAVLETAVADVSDEAQVE-AYVT
2c07A           ----NKVALVTGAGRG-IGREIAKMLAKSVSHVICISRTQKSCDSVVDEGYESYAGDVSKKEEISEVINK
2ae1A           ------TALVTGGSRG-IGYGIVEELASLGASVYTCSRNQKELDCLTQKGFEASVCDLSSRSERQELMNT
1jtvA           -------VLITGCS-SGIGLHLAVRLASQSFKVYATLRDLKTQGRLWEAALETLQLDVRDSKSVAAARER
3deyX           -------VLITGCS-SGIGLHLAVRLASQSFKVYATLRDLKTQGRLWEAALETLQLDVRDSKSVAAARER
1fdwA           -------VLITGCS-SGIGLHLAVRLASQSFKVYATLRDLKTQGRLWEAALETLQLDVRDSKSVAAARER
2ztlA           ---------------------------------------------------------------VDNAVRQ
2uvdA           -----KVALVTGASRG-IGRAIAIDLAKQGANVYAGNEQKANVDEIKKLGSDAIAVDVANAEDVTNMVKQ
2ztmC           ---------------------------------------------------------------VDNAVRQ
2q2wD           -----KTALVTG-STSGIGLGIAQVLARAGANIVLNGDPAPALAEIARHGVKAHPADLSDVAQIE-ALFA
2q2vC           -----KTALVTG-STSGIGLGIAQVLARAGANIVLNGDPAPALAEIARHGVKAHPADLSDVAQIE-ALFA
1fdsA           -------VLITGCS-SGIGLHLAVRLASQSFKVYATLRDLKTQGRLWEAALETLQLDVRDSKSVAAARER
2ztmD           ---------------------------------------------------------------VDNAVRQ
1fdvB           -------VLITGCS-SGIGLHLAVRLASQSFKVYATLRDLKTQGRLWEAALETLQLDVRDSKSVAAARER
1xu9B           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
1xu9A           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
1xu7D           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
1xu7B           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
1xu7A           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2rbeD           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2rbeC           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2rbeB           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2rbeA           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2irwC           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2irwA           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2iltA           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3hfgA           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3ey4C           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3ey4A           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3d5qB           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3d4nB           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3ch6E           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3ch6D           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3ch6B           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3ch6A           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3bzuB           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3bzuA           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3byzA           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2belD           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2belB           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2belA           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3czrA           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2ztvD           ---------------------------------------------------------------VDNAVRQ
2ztvC           ---------------------------------------------------------------VDNAVRQ
3hfgB           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3d4nD           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2q2qG           -----KTALVTG-STSGIGLGIAQVLARAGANIVLNGDPAPALAEIARHGVKAHPADLSDVAQIE-ALFA
2ztmB           ---------------------------------------------------------------VDNAVRQ
1xu9C           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2q2qE           -----KTALVTG-STSGIGLGIAQVLARAGANIVLNGDPAPALAEIARHGVKAHPADLSDVAQIE-ALFA
1nffA           -------------------------------------------DILDEEGMAAELADAARYVHLDKAAVD
3hfgC           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
1gegE           -----KVALVTGAGQG-IGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAVKVDVSDRDQVFAAVEQ
1gegA           -----KVALVTGAGQG-IGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAVKVDVSDRDQVFAAVEQ
3d4nC           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3d4nA           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3d3eB           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3d3eA           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2ztvB           ---------------------------------------------------------------VDNAVRQ
1x1tA           ---------------------------------------------------------------VDNAVRQ
2q2qB           -----KTALVTG-STSGIGLGIAQVLARAGANIVLNGDPAPALAEIARHGVKAHPADLSDVAQIE-ALFA
2ztuD           ---------------------------------------------------------------VDNAVRQ
2ztuC           ---------------------------------------------------------------VDNAVRQ
2ztuB           ---------------------------------------------------------------VDNAVRQ
2ztuA           ---------------------------------------------------------------VDNAVRQ
2q2wC           -----KTALVTG-STSGIGLGIAQVLARAGANIVLNGDPAPALAEIARHGVKAHPADLSDVAQIE-ALFA
2q2vD           -----KTALVTG-STSGIGLGIAQVLARAGANIVLNGDPAPALAEIARHGVKAHPADLSDVAQIE-ALFA
2q2qF           -----KTALVTG-STSGIGLGIAQVLARAGANIVLNGDPAPALAEIARHGVKAHPADLSDVAQIE-ALFA
3hfgD           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2belC           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
1xu9D           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2q2wA           -----KTALVTG-STSGIGLGIAQVLARAGANIVLNGDPAPALAEIARHGVKAHPADLSDVAQIE-ALFA
2q2vB           -----KTALVTG-STSGIGLGIAQVLARAGANIVLNGDPAPALAEIARHGVKAHPADLSDVAQIE-ALFA
2q2vA           -----KTALVTG-STSGIGLGIAQVLARAGANIVLNGDPAPALAEIARHGVKAHPADLSDVAQIE-ALFA
2q2qC           -----KTALVTG-STSGIGLGIAQVLARAGANIVLNGDPAPALAEIARHGVKAHPADLSDVAQIE-ALFA
2q2qA           -----KTALVTG-STSGIGLGIAQVLARAGANIVLNGDPAPALAEIARHGVKAHPADLSDVAQIE-ALFA
2p68B           -----KVSLVTGSTRG-IGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKYGVNLLSEESINKAFEE
2p68A           -----KVSLVTGSTRG-IGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKYGVNLLSEESINKAFEE
3frjA           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3d5qD           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2q2qH           -----KTALVTG-STSGIGLGIAQVLARAGANIVLNGDPAPALAEIARHGVKAHPADLSDVAQIE-ALFA
2ehdB           -------VLITGASRG-IGEATARLLHAKGYRVGLMARDEKRLQXXXXXXXXXXXXXXDVREEGDWARAA
3d5qC           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3d5qA           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
3bzuD           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTAR-----ETLQKVVSHCLELGAASAHYIAGTMED
3bzuC           -----KKVIVTGASKG-IGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE---LGAASAHYIAGTMED
2zk7B           -----KVVIVTGASMG-IGRAIAERFVDEGSKVI-----DLSIHDPGEAKYDHIECDVTNPDQV-KASID
1uznB           ----SRSVLVTG-GNRGIGLAIAQRLAADGHKVAVTHRGSGAPKGLF--GVE---VDVTDSDAVDRAFTA
1uznA           ----SRSVLVTG-GNRGIGLAIAQRLAADGHKVAVTHRGSGAPKGLF--GVE---VDVTDSDAVDRAFTA
1q7bB           -----KIALVTGASRG-IGRAIAETLAARGAKVIGTATSENGAQAISDANGKGLMLNVTDPASIESVLEK
1q7bA           -----KIALVTGASRG-IGRAIAETLAARGAKVIGTATSENGAQAISDANGKGLMLNVTDPASIESVLEK
2ehdA           -------VLITGASRG-IGEATARLLHAKGYRVGLMARDEKRLQXXXXXXXXXXXXXXDVREEGDWARAA
2dteA           -----KVVIVTGASMG-IGRAIAERFVDEGSKVI-----DLSIHDPGEAKYDHIECDVTNPDQV-KASID
3f9iA           -----KTSLITGAS-SGIGSAIARLLHKLGSKVIISGSNEEKLKSLGNALKDNYTIEVCNLANKEEC-SN
1q7cA           -----KIALVTGASRG-IGRAIAETLAARGAKVIGTATSENGAQAISDANGKGLMLNVTDPASIESVLEK
3g1tA           ----NRIILVTGASDG-IGREAALTYARYGATVILLGRNEEKLRRVAQQWFTLDLLTCTAEEC--RQVAD
2cfcA           ----SRVAIVTGASSGN-GLAIATRFLARGDRVAALDLSAETLEETARTHWHAYAADVADEGDVNAAIAA
2jahC           -------------------------------------------------------LDVADRQGVDAAVAS
2jahA           -------------------------------------------------------LDVADRQGVDAAVAS
3ezlA           ---------------GGIGTSICQRLHKDGFRVVASPRRVKWLEDQKALGFDFYASEVGDWDSTKQAF-D
1y5mA           -----KKVIVTGASKG-IGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLE---LGAASAHYIAGTMED
2d1yB           ----------------------------------------------------------------------
1nfrA           -----KVALVSGGARGGASHVRAV--AEGAKVVFGDIXXXXXXXXXXXXXXXRYVLDVTQPAQWKAAVDT
1uzlB           ----SRSVLVTG-GNRGIGLAIAQRLAADGHKVAVTHRGSGAPKGLF--GVEC---DVTDSDAVDRAFTA
1i01E           -----KIALVTGASRG-IGRAIAETLAARGAKVIGTATSENGAQAISDANGKGLMLNVTDPASIESVLEK
2et6A           -----KVVIITGAG-GGLGKYYSLEFAKLGAKVVVNDLKAADV--VVDEIVKNGGVAVADYNNVGDKIVE
2d1yD           ----------------------------------------------------------------------
2d1yC           ----------------------------------------------------------------------
2d1yA           ----------------------------------------------------------------------
3cxrA           -----KIALVTGASYG-IGFAIASAYAKAGATIVFNDINQELVDAYKAAGINAYVCDVTDEDGIQAMVAQ
1i01B           -----KIALVTGASRG-IGRAIAETLAARGAKVIGTATSENGAQAISDANGKGLMLNVTDPASIESVLEK
3gk3A           -----RVAFVTG-GMGGLGAAISRRLHDAGMAVAVSHSERNDHERDAGRDFKAYAVDVADFESCERCAEK
3gk3C           -----RVAFVTG-GMGGLGAAISRRLHDAGMAVAVSHSERNDHERDAGRDFKAYAVDVADFESCERCAEK
1cydA           --------LVTGAGKG-IGRDTVKALHASGAKVVAVTRTNSDLVSLAKEGIEPVCVDLGDWDATEKALGG
3cxtA           -----KIALVTGASYG-IGFAIASAYAKAGATIVFNDINQELVDAYKAAGINAYVCDVTDEDGIQAMVAQ
1xseA           -----KKVIVTGASKG-IGREIAYHLAKMGAHVVVTARSK---EALQKVVARCLELGAASAHYIAGSMED
1hdcA           --------------------------------------------------------DAARYQHLDVTIEE
3g49A           -----KKVIVTGASKG-IGREIAYHLAKMGAHVVVTARSK---EALQKVVARCLELGAASAHYIAGSMED
3dwfC           -----KKVIVTGASKG-IGREIAYHLAKMGAHVVVTARSK---EALQKVVARCLELGAASAHYIAGSMED
3dwfB           -----KKVIVTGASKG-IGREIAYHLAKMGAHVVVTARSK---EALQKVVARCLELGAASAHYIAGSMED
3dwfA           -----KKVIVTGASKG-IGREIAYHLAKMGAHVVVTARSK---EALQKVVARCLELGAASAHYIAGSMED
3gk3B           -----RVAFVTG-GMGGLGAAISRRLHDAGMAVAVSHSDHVSTWLMHERDFKAYAVDVADFESCERCAEK
3gk3D           -----RVAFVTG-GMGGLGAAISRRLHDAGHSVSTWLMHERD----AGRDFKAYAVDVADFESCERCAEK
1vl8B           -----RVALVTGGSRG-LGFGIAQGLAEAGCSVVVASRNLEEASEAAQKLTEKYGVDVSNYXXXXXXXXX
1vl8A           -----RVALVTGGSRG-LGFGIAQGLAEAGCSVVVASRNLEEASEAAQKLTEKYGVDVSNYXXXXXXXXX
1k2wA           ---DGKTALITGSARG-IGRAFAEAYVREGARVAIALEAARXXXXXXXXXXXXXXLDVTDQASIDRCVAE
2b4qA           --------LVTGGSRG-IGQMIAQGLLEAGARVFICAR---DAEALSAYGDCQAIPADLSSEAGARRLAQ
1spxA           -----KVAIITGSSNG-IGRATAVLFAREGAKVTITGRHAERLEGVSEQNVNSVVADVTTDAGQDEILST
1zbqA           -----------------------------------SLAADKVVEEIRRRGGKA----VANYDSVEEG--E
2ph3A           ----------------------------------------------------------------------
3gz4B           ---NDRIILVTGASDG-IGREAAMTYARYGATVILLGRNEEKLRQVASHINEEFILDLLTCTSEDQQLAQ
3gz4A           ---NDRIILVTGASDG-IGREAAMTYARYGATVILLGRNEEKLRQVASHINEEFILDLLTCTSEDQQLAQ
1g6kA           -----KVVVITGSSTG-LGKSMAIRFATEKAKVVVNYRSKEDLEEIKKVGGEAIAVDVTVESDVINLVQS
3ftpD           ---DKQVAIVTGASRG-IGRAIALELARRGAMVXXXXXXXXXXXXFKQAGLEGRVLNVNDATAVD-ALVE
3i3oG           -----KNVLITG-GDSGIGRAVSIAFAKEGANIIAYLDEEGDANETKQEGVKCVLLDLSDEQHCKDIVQE
3i3oF           -----KNVLITG-GDSGIGRAVSIAFAKEGANIIAYLDEEGDANETKQEGVKCVLLDLSDEQHCKDIVQE
3i3oE           -----KNVLITG-GDSGIGRAVSIAFAKEGANIIAYLDEEGDANETKQEGVKCVLLDLSDEQHCKDIVQE
3i3oC           -----KNVLITG-GDSGIGRAVSIAFAKEGANIIAYLDEEGDANETKQEGVKCVLLDLSDEQHCKDIVQE
3i3oB           -----KNVLITG-GDSGIGRAVSIAFAKEGANIIAYLDEEGDANETKQEGVKCVLLDLSDEQHCKDIVQE
3i3oA           -----KNVLITG-GDSGIGRAVSIAFAKEGANIIAYLDEEGDANETKQEGVKCVLLDLSDEQHCKDIVQE
1geeA           -----KVVVITGSSTG-LGKSMAIRFATEKAKVVVNYRSKEDLEEIKKVGGEAIAVDVTVESDVINLVQS
1gcoA           -----KVVVITGSSTG-LGKSMAIRFATEKAKVVVNYRSKEDLEEIKKVGGEAIAVDVTVESDVINLVQS
1xhlA           ---SGKSVIITGSSNG-IGRSAAVIFAKEGAQVTITGRNEDRLEETKQEKINAVVADVTEASGQDDIINT
3f5qA           ---NDRIILVTGASDG-IGREAAMTYARYGATVILLGRNEEKLRQVASHINEEFILDLLTCTSEDQQLAQ
1xkqB           ---SNKTVIITGSSN-GIGRTTAILFAQEGANVTITGRSSERLEGVSEKQVNSVVADVTTEDGQDQIINS
1xkqA           ---SNKTVIITGSSN-GIGRTTAILFAQEGANVTITGRSSERLEGVSEKQVNSVVADVTTEDGQDQIINS
3ijrH           -----KNVLITG-GDSGIGRAVSIAFAKEGANIIAYLDEEGDANETKQEGVKCVLLDLSDEQHCKDIVQE
3ijrF           -----KNVLITG-GDSGIGRAVSIAFAKEGANIIAYLDEEGDANETKQEGVKCVLLDLSDEQHCKDIVQE
3ijrE           -----KNVLITG-GDSGIGRAVSIAFAKEGANIIAYLDEEGDANETKQEGVKCVLLDLSDEQHCKDIVQE
3ijrB           -----KNVLITG-GDSGIGRAVSIAFAKEGANIIAYLDEEGDANETKQEGVKCVLLDLSDEQHCKDIVQE
3ijrA           -----KNVLITG-GDSGIGRAVSIAFAKEGANIIAYLDEEGDANETKQEGVKCVLLDLSDEQHCKDIVQE
3i3oH           -----KNVLITG-GDSGIGRAVSIAFAKEGANIIAYLDEEGDANETKQEGVKCVLLDLSDEQHCKDIVQE
3gafH           -------------------------LKSEGAEAVAAAIRQAGGKAI---GLECNVTDEQHREAVIKAALD
3gafG           -------------------------LKSEGAEAVAAAIRQAGGKAI---GLECNVTDEQHREAVIKAALD
3gafF           -------------------------LKSEGAEAVAAAIRQAGGKAI---GLECNVTDEQHREAVIKAALD
3gafE           -------------------------LKSEGAEAVAAAIRQAGGKAI---GLECNVTDEQHREAVIKAALD
3gafD           -------------------------LKSEGAEAVAAAIRQAGGKAI---GLECNVTDEQHREAVIKAALD
3gafC           -------------------------LKSEGAEAVAAAIRQAGGKAI---GLECNVTDEQHREAVIKAALD
3gafB           -------------------------LKSEGAEAVAAAIRQAGGKAI---GLECNVTDEQHREAVIKAALD
3gafA           -------------------------LKSEGAEAVAAAIRQAGGKAI---GLECNVTDEQHREAVIKAALD
3f9iB           -----KTSLITGAS-SGIGSAIARLLHKLGSKVIISGSNEEKLKSLGNALKDNYTIEVCNLANKEEC-SN
1zjyA           -------------------------------------------------------------------LFD
1rwbA           -----KVVVITGSSTG-LGKSMAIRFATEKAKVVVNYRSKEDLEEIKKVGGEAIAVDVTVESDVINLVQS
1nxqA           -------------------------------------------------------------------LFD
1i01A           -----KIALVTGASRG-IGRAIAETLAARGAKVIGTATSENGAQAISDANGKGLMLNVTDPASIESVLEK
3f5qB           ---NDRIILVTGASDG-IGREAAMTYARYGATVILLGRNEEKLRQVASHINEEFILDLLTCTSEDQQLAQ
2ag5C           -----------------------------GAKVIATDINESKLQELEKPGIQTRVLDVTKKKQIDQFANE
2ag5B           -----------------------------GAKVIATDINESKLQELEKPGIQTRVLDVTKKKQIDQFANE
2ag5A           -----------------------------GAKVIATDINESKLQELEKPGIQTRVLDVTKKKQIDQFANE
1fmcA           ------------------------------------------VDEIQQLGGQAFACDITSEQEL-SALAD
1ahhA           ------------------------------------------VDEIQQLGGQAFACDITSEQEL-SALAD
1yb1A           -------VLITGAGHG-IGRLTAYEFAKLKSKLVLWDINKHGLEETAAKKVHTFVVDCSNREDIYSSAKK
3i4fD           ----------------------------------------KDVE----ERLQFVQADVTKKEDLHKIVEE
3i4fC           ----------------------------------------KDVE----ERLQFVQADVTKKEDLHKIVEE
3i4fA           ----------------------------------------KDVE----ERLQFVQADVTKKEDLHKIVEE
2zatA           ----NKVALVTA-STDGIGLAIARRLAQDGAHVVVSSRKQENVDTLQGEGLSVTVCHVGKAEDRERLVAM
1yb1B           -------VLITGAGHG-IGRLTAYEFAKLKSKLVLWDINKHGLEETAAKKVHTFVVDCSNREDIYSSAKK
1n5dA           --SNTRVALVTGANKG-IGFAIVRDLQFAGDVVLTAARGQAAVKQLQAEGLSPHQLDIIDLQSI-RALCD
3ftpC           ---DKQVAIVTGASRG-IGRAIALELARRGAMVXXXXXXXXXXXXFKQAGLEGRVLNVNDATAVD-ALVE
3f1lB           ---NDRIILVTGASDG-IGREAAMTYARYGATVILLGRNEEKLRQVASHINEEFILDLLTCTSENQQLAQ
3f1lA           ---NDRIILVTGASDG-IGREAAMTYARYGATVILLGRNEEKLRQVASHINEEFILDLLTCTSENQQLAQ
2zk7A           -----KVVIVTGASMG-IGRAIAERFVDEGSKVI-----DLSIHDPGEAKYDHIECDVTNPDQV-KASID
3gy0A           ---NDRIILVTGASDG-IGREAAMTYARYGATVILLGRNEEKLRQVASQWFILDLLTCTSENCQQLAQRI
3guyG           -------IVITGAS-SGLGAELAKLYDAEGKATYLTGRSESKLSTVTN-----CLSNNVGYRARDLASHQ
1wmaA           --------LVTG-GNKGIGLAIVRDLCRLGDVVLTATRGQAAVQQLQAEGLSPHQLDIDDLQSI-RALRD
1o5iA           -----KGVLVLAASRG-IGRAVADVLSQEGAEVTICARNE---ELLKRSGHRYVVCDLRKD-------LD
1i01F           -----KIALVTGASRG-IGRAIAETLAARGAKVIGTATSENGAQAISDANGKGLMLNVTDPASIESVLEK
3guyD           -------IVITGAS-SGLGAELAKLYDAEGKATYLTGRSESKLSTVTN-----CLSNNVGYRARDLASHQ
3bhmA           --------LVTG-GNKGIGLAIVRDLCRLGDVVLTATRGQAAVQQLQAEGLSPHQLDIDDLQSI-RALRD
3ftpA           ---DKQVAIVTGASRG-IGRAIALELARRGAMVXXXXXXXXXXXXFKQAGLEGRVLNVNDATAVD-ALVE
1edoA           ----SPVVVVTGASRG-IGKAIALSLGKAGCKVLVNARSAKAAEEVSKQ-IEAYGGQAITFGGDVSKEAD
2pfgA           --------LVTG-GNKGIGLAIVRDLCRLGDVVLTATRGQAAVQQLQAEGLSPHQLDIDDLQSI-RALRD
2hq1A           -----KTAIVTGSSRG-LGKAIAWKLGNMGANIVASTSLDATAEEFKAAGINVVVADVKNPEDVENMVKT
3gvcD           -------------------------------------------------------VDVSDEQQII-AMVD
3gvcC           -------------------------------------------------------VDVSDEQQII-AMVD
3gvcB           -------------------------------------------------------VDVSDEQQII-AMVD
3gvcA           -------------------------------------------------------VDVSDEQQII-AMVD
3emkB           --------LVTGAT-GGLGEAIARALHAQGAIVLHGTRELKELAAELGERIFVFPANLSDREAV-KALGQ
1gz6A           -----------------------------------SSAADKVVEEIRRRGGKA----VANYDSVEEKLVK
3f5sB           ---NDRIILVTGASDG-IGREAAMTYARYGATVILLGRNEEKLRQVASQWFILDLLTCTSENCQQLAQRI
3f5sA           ---NDRIILVTGASDG-IGREAAMTYARYGATVILLGRNEEKLRQVASQWFILDLLTCTSENCQQLAQRI
2b4qB           --------LVTGGSRG-IGQMIAQGLLEAGARVFICAR---DAEALSAYGDCQAIPADLSSEAGARRLAQ
1ybvA           -----KVALVTGAGRG-IGREMAMELGRRGCKVYANSTESAEVAAIKKNGSDAACVNVGVVEDIVRMFEE
2ph3B           ----------------------------------------------------------------------
1i01D           -----KIALVTGASRG-IGRAIAETLAARGAKVIGTATSENGAQAISDANGKGLMLNVTDPASIESVLEK
1g0oC           -----KVALVTGAGRG-IGREMAMELGRRGCKVYANSTESAEVAAIKKNGSDAACVNVGVVEDIVRMFEE
1g0oA           -----KVALVTGAGRG-IGREMAMELGRRGCKVYANSTESAEVAAIKKNGSDAACVNVGVVEDIVRMFEE
1g0nB           -----KVALVTGAGRG-IGREMAMELGRRGCKVYANSTESAEVAAIKKNGSDAACVNVGVVEDIVRMFEE
1dohB           -----KVALVTGAGRG-IGREMAMELGRRGCKVYANSTESAEVAAIKKNGSDAACVNVGVVEDIVRMFEE
1dohA           -----KVALVTGAGRG-IGREMAMELGRRGCKVYANSTESAEVAAIKKNGSDAACVNVGVVEDIVRMFEE
2pd6D           ----SALALVTGAG-SGIGRAVSVRLAGEGATVAACAAAQETVRLLNHAAFQA---DVSEARAARCLLEQ
1xq1A           ----AKTVLVTGGTKG-IGHAIVEEFAGFGAVIHTCARNEYELECLSKKGFQVTVCDASLRPEREKLMQT
2pd6C           --------LVTGAG-SGIGRAVSVRLAGEGATVAACAAAQETVRLLNHAAFQA---DVSEARAARCLLEQ
2gdzA           ----------------------------------------------------------------------
2pd3A           -LKGKKGLIVGVANNKSIAYGIAQSCFNQGATLYLNESLEKRVRPIAQELNSPYVLDVSKEEHF-KSLYN
1i01C           -----KIALVTGASRG-IGRAIAETLAARGAKVIGTATSENGAQAISDANGKGLMLNVTSIE----SVLE
1gz6C           -----------------------------------SSAADKVVEEIRRRGGKA----VANYDSVEEKLVK
1gz6B           -----------------------------------SSAADKVVEEIRRRGGKA----VANYDSVEEKLVK
1i01H           -----KIALVTGASRG-IGRAIAETLAARGAKVIGTATSENGAQAISDANGKGLMLNVTDPASIESVLEK
1i01G           -----KIALVTGASRG-IGRAIAETLAARGAKVIGTATSENGAQAISDANGKGLMLNVTDPASIESVLEK
3guyH           -------IVITGAS-SGLGAELAKLYDAEGKATYLTGRSESKLSTVTN-----CLSNNVGYRARDLASHQ
3guyC           -------IVITGAS-SGLGAELAKLYDAEGKATYLTGRSESKLSTVTN-----CLSNNVGYRARDLASHQ
2fwmX           ---SGKNVWVTGAGKG-IGYATALAFVEAGAKVFDQAFTQE------QYPFATEXXXXXXXXXXXXXCQR
2bgkA           --------------------------------------------------------DVTKDEDVRN-LVD
2pd6B           ----SALALVTGAG-SGIGRAVSVRLAGEGATVAACAAAQETVRLLGNHA--AFQADVSEARAARCLLEQ
3ennA           --------LVTGAT-GGLGEAIARALHAQGAIVGLHGTRXXXXXXXXXXXGERIFVFPANLSDREKALGQ
2pd6A           ----SALALVTGAG-SGIGRAVSVRLAGEGATVAACAAAQETVRLLNHAAFQA---DVSEARAARCLLEQ
3guyA           -------IVITGAS-SGLGAELAKLYDAEGKATYLTGRSESKLSTVTN-----CLSNNVGYRARDLASHQ
2ewmB           -------------------------IRNLGRRVLTDVSQPGDVEAFGKQVISTF----------------
2ewmA           -------------------------IRNLGRRVLTDVSQPGDVEAFGKQVISTF----------------
2ew8B           -------------------------IRNLGRRVLTDVSQPGDVEAFGKQVISTF----------------
2ew8A           -------------------------IRNLGRRVLTDVSQPGDVEAFGKQVISTF----------------
3emkA           --------LVTGAT-GGLGEAIARALHAQGAIVGLHGTRXXXXXXXXXXXGERIFVFPANLSDREKALGQ
3bmeB           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3emkD           --------LVTGAT-GGLGEAIARALHAQGAIVGLHGTRXXXXXXXXXXXGERIFVFPANLSDREKALGQ
3bmjD           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
1yxmD           ----------------GIGKAIVKELLELGSNVVIASRKLERLKSAADE-LQANLANIRNEEEVNNLVKS
1ulsC           -----KAVLITGAAH-GIGRATLELFAKEGARLVACDIEEGPLREAAEAVGAHPVVDVADPASVERGFAE
3guyB           -------IVITGAS-SGLGAELAKLYDAEGKATYLTGRSESKLSTVTN-----CLSNNVGYRARDLASHQ
3ennB           --------LVTGAT-GGLGEAIARALHAQGAIVGLHGTRXXXXXXXXXXXGERIFVFPANLSDREKALGQ
2wd7B           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3bmnC           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3bmeA           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
2vz0B           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
1ulsB           -----KAVLITGAAHG-IGRATLELFAKEGARLVACDIEEGPLREAAEAVGAHPVVDVADPASVERGFAE
1ulsA           -----KAVLITGAAHG-IGRATLELFAKEGARLVACDIEEGPLREAAEAVGAHPVVDVADPASVERGFAE
3grkG           ---------------------------------------KKRVEPLAEEAFVAGHCDVADAASID-AVFE
3bmfD           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3bmdB           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
1yxmB           ----------------GIGKAIVKELLELGSNVVIASRKQANLPPTKQARVIPIQCNIRNEEEVNNLVKS
2wd7C           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3bmoD           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3bmoC           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
1yxmA           ----------------GIGKAIVKELLELGSNVVIASRKQANLPPTKQARVIPIQCNIRNEEEVNNLVKS
2vz0A           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3iahA           ----NRIILVTGASDG-IGREAALTYARYGATVILLGRNEEKLRRVAQQWFTLDLLTCTAEEC--RQVAD
3ennD           --------LVTGAT-GGLGEAIARALHAQGAIVGLHGTRXXXXXXXXXXXGERIFVFPANLSDREKALGQ
3ennC           --------LVTGAT-GGLGEAIARALHAQGAIVGLHGTRXXXXXXXXXXXGERIFVFPANLSDREKALGQ
3emkC           --------LVTGAT-GGLGEAIARALHAQGAIVGLHGTRXXXXXXXXXXXGERIFVFPANLSDREKALGQ
2c7vB           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
2c7vA           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3bmfA           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
2c7vD           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3bmqA           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3bmkC           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
2yw9H           -LSGKKALVMGVTNQRSLGFAIAAKLKEAGAEVALSYQAERXXXXXXXXXXXXFRADVTQDEELDALFAG
3iccA           -----KVALVTGASRG-IGRAIAKRLANDGALVAIHYGNRKEVYEIQSNGGSAFSIGANLYSSLDNELQ-
3bmqC           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3bmnD           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3grkA           ---------------------------------------KKRVEPLAEEAFVAGHCDVADAASID-AVFE
3bmeC           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
1fk8A           -------IVISGCATG-IGAATRKVLEAAGHQIVGIDIRDAEVIA-----------DLSTAEGRKQAIAD
1fjhA           -------IVISGCATG-IGAATRKVLEAAGHQIVGIDIRDAEVIA-----------DLSTAEGRKQAIAD
3bmoB           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3bmnA           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3bmiB           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3bmfC           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3bmfB           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3grkB           ---------------------------------------KKRVEPLAEEAFVAGHCDVADAASID-AVFE
3e9nC           -----KIAVVTGAT-GGMGIEIVKDLSR-DHIVYALGRNPEHLAALAEEGVEPIESDIVK-EVLEEGGVD
3e9nA           -----KIAVVTGAT-GGMGIEIVKDLSR-DHIVYALGRNPEHLAALAEEGVEPIESDIVK-EVLEEGGVD
3bmnB           --------VVTGAAKR-IGRAIAVKLHQTGYRVVIHYHNSAEADELNKERSNTAVVDLTNSNVLPASCEE
3k2eB           --------------------------------------------------------DVSDAESVDN-MFK
3grpA           -------------------------------------------------------------------LAE
3grkD           ---------------------------------------KKRVEPLAEEAFVAGHCDVADAASID-AVFE
3f1kA           ---NDRIILVTGASDG-IGREAATYARYGATVILLGRNEEKLRQVASHINEETFILDLLTCTSENQQLAQ
1a4uA           ---------------GGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYVTVPVAE
3grpD           -------------------------------------------------------------------LAE
3grpB           -------------------------------------------------------------------LAE
2z1nB           -------LAVVTAGSSGLGFASALELARNGARLLLFSRNREKLEAAASR-----IASLVSGAQVDIVAGD
2z1nA           -------LAVVTAGSSGLGFASALELARNGARLLLFSRNREKLEAAASR-----IASLVSGAQVDIVAGD


                         .         .         *         .         .         .         .:140
query           ILNKTGGSLDVIFNNAGYGQAGALEDIDTKFLKQQFETNVFGLHNLTYKALKIMRKQGYGKIIQHSSVLG
1zemA           VV-RDFGKIDFLFNNAGYGAFAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQNYGRIVNTASMAG
2japC           TVEALGG-LDILVNNAGIMLLGPVEDADTTDWTRMIDTNLLGLMYMTRAALPHLLRSK-GTVVQMSSIAG
2japA           TVEALGG-LDILVNNAGIMLLGPVEDADTTDWTRMIDTNLLGLMYMTRAALPHLLRSK-GTVVQMSSIAG
1iolA           V---TEGRVDVLVCNXXXXXXXXXXXXXXDAVASVLEVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
1bhsA           V---TEGRVDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
1a27A           V---TEGRVDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
2yz7A           AAEALGG-LDILVNNAGIQHTAPIEEFPVDKWNAIIALNLSAVFHGTAAALPIMQKQGWGRIINIASAHG
1fduD           V---TEGRVDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
1ae1B           VFD---GKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAG
1xr3B           VVERYG-PVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGG
1x7hB           VVERYG-PVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGG
1w4zB           VVERYG-PVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGG
1w4zA           VVERYG-PVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGG
2rh4B           VVERYG-PVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGG
2rh4A           VVERYG-PVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGG
1x7gB           VVERYG-PVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGG
1x7gA           VVERYG-PVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGG
2rhrB           VVERYG-PVDVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGG
1fduA           V---TEGRVDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
3csdB           VVERYG-PVDVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGG
2bd0A           VRRLTTGHIDCLVNNAGVGRFGALSDLTEEDFDYTMNTNLKGTFFLTQALFALMERQHSGHIFFITSVAA
1xg5C           IRSQHSG-VDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVGHIININSMSG
1xg5B           IRSQHSG-VDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVGHIININSMSG
1xg5A           IRSQHSG-VDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVGHIININSMSG
1fduC           V---TEGRVDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
2rhrA           VVERYG-PVDVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGG
1ae1A           VFD---GKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAG
2ae2A           VANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSG
1fduB           V---TEGRVDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
2ztmA           M-----GRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHG
1qyxA           V---TEGRVDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
1qyvA           V---TEGRVDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
1iy8A           ATTERFGRIDGFFNNAGIGKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGMVVNTASVGG
2c07A           ILTEHK-NVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVG
2ae1A           VANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSG
1jtvA           V---TEGRVDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
3deyX           V---TEGRVDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
1fdwA           V---TEGRVDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
2ztlA           M-----GRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHG
2uvdA           TVD-VFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRHGRIVNIASVVG
2ztmC           M-----GRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHG
2q2wD           LAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHG
2q2vC           LAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHG
1fdsA           V---TEGRVDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
2ztmD           M-----GRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHG
1fdvB           V---TEGRVDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGG
1xu9B           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
1xu9A           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
1xu7D           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
1xu7B           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
1xu7A           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2rbeD           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2rbeC           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2rbeB           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2rbeA           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2irwC           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2irwA           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2iltA           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3hfgA           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3ey4C           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3ey4A           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3d5qB           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3d4nB           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3ch6E           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3ch6D           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3ch6B           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3ch6A           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3bzuB           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3bzuA           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3byzA           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2belD           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2belB           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2belA           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3czrA           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2ztvD           M-----GRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHG
2ztvC           M-----GRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHG
3hfgB           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3d4nD           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2q2qG           LAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHG
2ztmB           M-----GRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHG
1xu9C           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2q2qE           LAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHG
1nffA           TAVTAFGGLHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSIEG
3hfgC           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
1gegE           A-RKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGKIINACSQAG
1gegA           A-RKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGKIINACSQAG
3d4nC           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3d4nA           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3d3eB           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3d3eA           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2ztvB           M-----GRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHG
1x1tA           M-----GRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHG
2q2qB           LAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHG
2ztuD           M-----GRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHG
2ztuC           M-----GRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHG
2ztuB           M-----GRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHG
2ztuA           M-----GRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHG
2q2wC           LAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHG
2q2vD           LAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHG
2q2qF           LAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHG
3hfgD           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2belC           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
1xu9D           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2q2wA           LAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHG
2q2vB           LAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHG
2q2vA           LAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHG
2q2qC           LAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHG
2q2qA           LAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHG
2p68B           IYNLVDG-IDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVG
2p68A           IYNLVDG-IDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVG
3frjA           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3d5qD           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2q2qH           LAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHG
2ehdB           AMEEAFGELSALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGGTIVNVGSLAG
3d5qC           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3d5qA           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3bzuD           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
3bzuC           MTGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGSIVVVSSLAG
2zk7B           HIFKEYGSISVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISSVQA
1uznB           V-EEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSG
1uznA           V-EEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSG
1q7bB           IRAEFG-EVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVG
1q7bA           IRAEFG-EVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVG
2ehdA           AMEEAFGELSALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGGTIVNVGSLAG
2dteA           HIFKEYGSISVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISSVQA
3f9iA           LISKTS-NLDILVCNAG--------DFD-----KVIDINLKANFILNREAIKKMIQKRYGRIINISSIVG
1q7cA           IRAEFG-EVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVG
3g1tA           RIAAHYPRLDGVLHNAGLGEIGPMSEQDPQIWQDVMQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSVG
2cfcA           TMEQFG-AIDVLVNNAGISEAGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGVIVNIASVAS
2jahC           TVEALGG-LDILVNNAGI-LLGPVEDADTTDWTR-IDTNLLGLY--TRAALPLLRSKG---TVVQSSIAG
2jahA           TVEALGG-LDILVNNAGI-LLGPVEDADTTDWTR-IDTNLLGLY--TRAALPLLRSKG---TVVQSSIAG
3ezlA           KVKAEVGEIDVLVNNAGITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSVNG
1y5mA           MTGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPML-KQSNGSIAVISSLAG
2d1yB           ------GRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQG
1nfrA           AVTAFGG-LHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVF-LGIRAVVKPKEAGRGSIINISSIEG
1uzlB           V-EEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSG
1i01E           IRAEFG-EVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVG
2et6A           TAVKNFGTVHVIINNAGILRDASMKKMTEKDYKLVIDVHLNGAFAVTKAAWPYFQKQKYGRIVNTSSPAG
2d1yD           ------GRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQG
2d1yC           ------GRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQG
2d1yA           ------GRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQG
3cxrA           IESEVG-IIDILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMS
1i01B           IRAEFG-EVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVG
3gk3A           VLADFG-KVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSVNG
3gk3C           VLADFG-KVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSVNG
1cydA           I-----GPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVGSIVNVSSMVA
3cxtA           IESEVG-IIDILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMS
1xseA           MTNLMGGLDMLILNHVLYNRLTFFHEIDN--VRKSMEVNFHSFVVLSVAAMPMLM-QSQGSIAVVSSVAG
1hdcA           YAREEFGSVDGLVNNAGISTGMFLETESVERFRKVVEINLTGVFIGMKTVIPAMKDAGGGSIVNISSAAG
3g49A           MTNLMGGLDMLILNHVLYNRLTFFHEIDN--VRKSMEVNFHSFVVLSVAAMPMLM-QSQGSIAVVSSVAG
3dwfC           MTNLMGGLDMLILNHVLYNRLTFFHEIDN--VRKSMEVNFHSFVVLSVAAMPMLM-QSQGSIAVVSSVAG
3dwfB           MTNLMGGLDMLILNHVLYNRLTFFHEIDN--VRKSMEVNFHSFVVLSVAAMPMLM-QSQGSIAVVSSVAG
3dwfA           MTNLMGGLDMLILNHVLYNRLTFFHEIDN--VRKSMEVNFHSFVVLSVAAMPMLM-QSQGSIAVVSSVAG
3gk3B           VLADFG-KVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSVNG
3gk3D           VLADFG-KVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSVNG
1vl8B           XXXXFG-KLDTVVNAAGINRRHPAEEFPLDEFRQVIEVNLFGTYYVCREAFSLLRESDNPSIINIGSLVE
1vl8A           XXXXFG-KLDTVVNAAGINRRHPAEEFPLDEFRQVIEVNLFGTYYVCREAFSLLRESDNPSIINIGSLVE
1k2wA           LLDRWG-SIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGRGKIINMASQAG
2b4qA           ALGELSARLDILVNNAGTSWGAALESYPVSGWEKVMQLNVTSVFSCIQQLLPLLRRENPARVINIGSVAG
1spxA           TLGKF-GKLDILVNNAGQ----SIESYDA-----TLNLNLRSVIALTKKAVPHL-SSTKGEIVNISSIAG
1zbqA           KVVKTAGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASG
2ph3A           ------GGLDTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKARFGRIVNITSVVG
3gz4B           RIAVNYPRLDGVLHNAGLGDVCPMSEQDPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSVG
3gz4A           RIAVNYPRLDGVLHNAGLGDVCPMSEQDPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSVG
1g6kA           AI-KEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKFVENDIKGTVINMSSVHE
3ftpD           STLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVG
3i3oG           TVRQLG-SLNILVNNVAYPQQG-LEYITAEQLEKTFRINIFSYFHVTKAALSHL-KQG-DVIINTASIVA
3i3oF           TVRQLG-SLNILVNNVAYPQQG-LEYITAEQLEKTFRINIFSYFHVTKAALSHL-KQG-DVIINTASIVA
3i3oE           TVRQLG-SLNILVNNVAYPQQG-LEYITAEQLEKTFRINIFSYFHVTKAALSHL-KQG-DVIINTASIVA
3i3oC           TVRQLG-SLNILVNNVAYPQQG-LEYITAEQLEKTFRINIFSYFHVTKAALSHL-KQG-DVIINTASIVA
3i3oB           TVRQLG-SLNILVNNVAYPQQG-LEYITAEQLEKTFRINIFSYFHVTKAALSHL-KQG-DVIINTASIVA
3i3oA           TVRQLG-SLNILVNNVAYPQQG-LEYITAEQLEKTFRINIFSYFHVTKAALSHL-KQG-DVIINTASIVA
1geeA           AI-KEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKFVENDIKGTVINMSSVHE
1gcoA           AI-KEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKFVENDIKGTVINMSSVHE
1xhlA           TLAKFG-KIDILVNNAGANLADGTANTDVELYQKTFKLNFQAVIEMTQKTKEHLIKT-KGEIVNVSSIVG
3f5qA           RIAVNYPRLDGVLHNAGLGDVCPMSEQDPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSVG
1xkqB           TL-KQFGKIDVLVNNAGFGTTGTDQGID--IYHKTLKLNLQAVIEMT-KKVKPHLVASKGEIVNVSSIVG
1xkqA           TL-KQFGKIDVLVNNAGFGTTGTDQGID--IYHKTLKLNLQAVIEMT-KKVKPHLVASKGEIVNVSSIVG
3ijrH           TVRQLG-SLNILVNNVAYPQQG-LEYITAEQLEKTFRINIFSYFHVTKAALSHL-KQG-DVIINTASIVA
3ijrF           TVRQLG-SLNILVNNVAYPQQG-LEYITAEQLEKTFRINIFSYFHVTKAALSHL-KQG-DVIINTASIVA
3ijrE           TVRQLG-SLNILVNNVAYPQQG-LEYITAEQLEKTFRINIFSYFHVTKAALSHL-KQG-DVIINTASIVA
3ijrB           TVRQLG-SLNILVNNVAYPQQG-LEYITAEQLEKTFRINIFSYFHVTKAALSHL-KQG-DVIINTASIVA
3ijrA           TVRQLG-SLNILVNNVAYPQQG-LEYITAEQLEKTFRINIFSYFHVTKAALSHL-KQG-DVIINTASIVA
3i3oH           TVRQLG-SLNILVNNVAYPQQG-LEYITAEQLEKTFRINIFSYFHVTKAALSHL-KQG-DVIINTASIVA
3gafH           QF----GKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAG
3gafG           QF----GKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAG
3gafF           QF----GKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAG
3gafE           QF----GKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAG
3gafD           QF----GKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAG
3gafC           QF----GKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAG
3gafB           QF----GKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAG
3gafA           QF----GKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAG
3f9iB           LISKTS-NLDILVCNAGITDFDKVIDIN---LKANFILN--------REAIKKMIQKRYGRXXXXXXXXX
1zjyA           ATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGSIINMSSIEG
1rwbA           AI-KEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKFVENDIKGTVINMSSVHE
1nxqA           ATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGSIINMSSIEG
1i01A           IRAEFG-EVDILVNNANL-----LMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVG
3f5qB           RIAVNYPRLDGVLHNAGLGDVCPMSEQDPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSVG
2ag5C           VER-----LDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAS
2ag5B           VER-----LDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAS
2ag5A           VER-----LDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAS
1fmcA           FAISKLGKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAA
1ahhA           FAISKLGKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAA
1yb1A           VKAEIG-DVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASA-A
3i4fD           AMSHFG-KIDFLINNAGVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGRIINYDSAPG
3i4fC           AMSHFG-KIDFLINNAGVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGRIINYDSAPG
3i4fA           AMSHFG-KIDFLINNAGVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGRIINYDSAPG
2zatA           AVNLHGG-VDILVSNAAVNPFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEKRXXXXXXXXXXXXA
1yb1B           VKAEIG-DVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVAS--A
1n5dA           FLRKEYGGLDVLVNNA----AIAFQDNPTPFHIQTMKTNFMGTRNVCTELLPLIKPQ--GRVVNVSSTEG
3ftpC           STLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVG
3f1lB           RIAVNYPRLDGVLHNAGLGDVCPMSEQNPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSVG
3f1lA           RIAVNYPRLDGVLHNAGLGDVCPMSEQNPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSVG
2zk7A           HIFKEYGSISVLVNNASMGEWRRIIDV-----------NLFGYYYASKFAIPYMIRSRDPSIVNISSV--
3gy0A           VVNYP--RLDGVLHNAGLGDVCPMSEQNPQVWQDVMQINVNATFMLTQALLPLLLKSDAGSLVFTSSSVG
3guyG           EVEQLFEQLDTVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVN-VVMIMSTAA
1wmaA           FLRKEYGGLDVLVNNAGI--AFKVADPTPFHIQAEMKTNFFGTRDVCTELLPLIKPQ--GRVVNVSSIMS
1o5iA           LLFEKVKEVDILVLNAGGPKAGFFDELTNEDFKEAIDSLFLNMIKIVRNYLPAMKEKGWGRIVAITSFSV
1i01F           IRAEFG-EVDILVNNAG----NLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVA
3guyD           EVEQLFEQLDTVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVN-VVMIMSTAA
3bhmA           FLRKEYGGLDVLVNNAGI--AFKVADPTPFHIQAEMKTNFFGTRDVCTELLPLIKPQ--GRVVNVSSIMS
3ftpA           STLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVG
1edoA           VMMKTAGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXXXXXXASVVG
2pfgA           FLRKEYGGLDVLVNNAGI--AFKVADPTPFHIQAEMKTNFFGTRDVT-ELLPLIKPQ--GRVVNVSSIMS
2hq1A           AMDAFG-RIDILVNNAW-------DDV--------LNTNLKSAYLCTKAVSKIMLKQKSGKIINITS---
3gvcD           ACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAG
3gvcC           ACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAG
3gvcB           ACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAG
3gvcA           ACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAG
3emkB           KAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXXXXXXTSIVG
1gz6A           TALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVT-RAAWDHKKQNYGRIIT-ASASG
3f5sB           VVNYP--RLDGVLHNAGLGDVCPMSEQNPQVWQDVMQINVNATFMLTQALLPLLLKSDAGSLVFTSSSVG
3f5sA           VVNYP--RLDGVLHNAGLGDVCPMSEQNPQVWQDVMQINVNATFMLTQALLPLLLKSDAGSLVFTSSSVG
2b4qB           ALGELSARLDILVNNAGTSPVSGWEKV--------MQLNVTSVFSCIQQLLPLLRRENPARVINIGSVAG
1ybvA           AV-KIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHL--EIGGRLILMGSITG
2ph3B           ------GGLDTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKARFGRIVNITSVVG
1i01D           IRAEFG-EVDILVNNDNL-----LMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVV-
1g0oC           AV-KIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHL--EIGGRLILMGSITG
1g0oA           AV-KIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHL--EIGGRLILMGSITG
1g0nB           AV-KIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHL--EIGGRLILMGSITG
1dohB           AV-KIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHL--EIGGRLILMGSITG
1dohA           AV-KIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHL--EIGGRLILMGSITG
2pd6D           VQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVG
1xq1A           VSSMFGGKLDILINN-----LGAL-DYTAEDFSFHISTNLESAYHLSQLAHPLLKASGCGNIIFMS---G
2pd6C           VQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVG
2gdzA           ------GRLDILVNNAGVN--------NEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEIINMSSLAG
2pd3A           SVKKDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTSVYSLIELTNTLKPLLNN---GASVLTLSYLG
1i01C           KIRAEFGEVDILVNNDNL-----LMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVV-
1gz6C           TALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVT-RAAWDHKKQNYGRIIT-ASASG
1gz6B           TALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVT-RAAWDHKKQNYGRIIT-ASASG
1i01H           IRAEFG-EVDILVNNAD----NLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRII----TIG
1i01G           IRAEFG-EVDILVNNAD----NLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRII----TIG
3guyH           EVEQLFEQLDTVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVN-VVMIMSTAA
3guyC           EVEQLFEQLDTVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVN-VVMIMSTAA
2fwmX           LLAET-ERLDALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQRGGAIVTVASDAA
2bgkA           TTIAKHGKLDIMFGNVGVLSTTSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAKKGSIVFTASISS
2pd6B           VQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVG
3ennA           KAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXXXXXXTSIVG
2pd6A           VQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVG
3guyA           EVEQLFEQLDTVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVN-VVMIMSTAA
2ewmB           ------GRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTY
2ewmA           ------GRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTY
2ew8B           ------GRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTY
2ew8A           ------GRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTY
3emkA           KAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXXXXXXTSIVG
3bmeB           IINRAFGRCDVLVNNASFYPTPLVKTVETQ-VAELIGTNAIAPFLLT---MSFAQRQNLSIVNLCDAMVD
3emkD           KAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXXXXXXTSIVG
3bmjD           IINRAFGRCDVLVNNASFYPTPLVKTVETQ-VAELIGTNAIAPFLLT---MSFAQRQSNLSIVNLCDAMV
1yxmD           TLD-TFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNVPTKAG
1ulsC           ALAHL-GRLDGVVHYAGITRDNPLEDWEL-----VLRVNLTGSF-LVAKAASEAREKNPGSIVLTASRV-
3guyB           EVEQLFEQLSIVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYKDQPVN-VVMIMSTAA
3ennB           KAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXXXXXXTSIVG
2wd7B           IINRAFGRCDVLVNNASYPTPLVGKTVETQ-VAELIGTNAIAPFLLT---MSFAQRQNLSIVNLCDAMVD
3bmnC           IINRAFGRCDVLVNNASYPTPLVGKTVETQ-VAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVD
3bmeA           IINRAFGRCDVLVNNASYPTPLVGKTVETQ-VAELIGTNAIAPFLLT---MSFAQRQSNLSIVNLCDAMV
2vz0B           IINRAFGRCDVLVNNASYPTPLVGKTVETQ-VAELIGTNAIAPFLLT---MSFAQRQNLSIVNLCDAMVD
1ulsB           ALAHLG-RLDGVVHYAGITRDNPLEDWELVL-----RVNLTGSF-LVAKAASEAREKNPGSIVLTASRV-
1ulsA           ALAHLG-RLDGVVHYAGITRDNPLEDWELVL-----RVNLTGSF-LVAKAASEAREKNPGSIVLTASRV-
3grkG           TLEKKWGKLDFLVHAIGFSDTGRYIDTSEANFTNTMLISVYSLTAVSRRAEKLMADGGYGKVMPNYNVMG
3bmfD           IINRAFGRCDVLVNNASYPTPLVGKTVETQ-VAELIGTNAIAPFLLT---MSFAQRQSNLSIVNLCDAMV
3bmdB           IINRAFGRCDVLVNNASYPTPLVGKTVETQ-VAELIGTNAIAPFLLT---MSFAQRQNLSIVNLCDAMVD
1yxmB           TLD-TFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNVPTKAG
2wd7C           IINRAFGRCDVLVNNASYPTPLVGKTVETQ-VAELIGTNAIAPFLLT---MSFAQRQSNLSIVNLCDAMV
3bmoD           IINRAFGRCDVLVNNASYPTPLVGKTVETQ-VAELIGTNAIAPFLLTMSFAQRQKGSNLSIVNLCDAMVD
3bmoC           IINRAFGRCDVLVNNASAFYPTPLKTVETQ-VAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVD
1yxmA           TLD-TFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNVPTKAG
2vz0A           IINRAFGRCDVLVNNASYPTPLVGKTVETQ-VAELIGTNAIAPFLLT---MSFAQRQSNLSIVNLCDAMV
3iahA           RIAAHYPRLDGVLHNAGLGEIGPSEQDPQ--IWQDVQVNVNATF-LTQAXXXXXXKSDAGSLVFTSSSVG
3ennD           KAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXXXXXXTSIVG
3ennC           KAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXXXXXXTSIVG
3emkC           KAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXXXXXXTSIVG
2c7vB           IINRAFGRCDVLVNNASAFYPTPLKTVETQ-VAELIGTNAIAPFLLTMSFAQRQKTSSNLSIVNLCDAMV
2c7vA           IINRAFGRCDVLVNNASAFYPTPLKTVETQ-VAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMV
3bmfA           IINRAFGRCDVLVNNASYPTPLVGKTVETQ-VAELIGTNAIAPFLLT---MSFAQRQSNLSIVNLCDAMV
2c7vD           IINRAFGRCDVLVNNASYPTPLVQGDHNGKTVETQVATNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMV
3bmqA           IINRAFGRCDVLVNNASAFYPTPLKTVETQ-VAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMV
3bmkC           IINRAFGRCDVLVNNASYPTPLVGKTVETQ-VAELIGTNAIAPFLLTMSFAQ--RQKNLSIVNLCDAMVD
2yw9H           VKEAFGG-LDYLVHAIAFAPREAMEGIDTR--RQDWEVSAYSLVAVARRAEPLLREGG-----------G
3iccA           --NRTGSTFDILINNAGIGPGAFIEETTEQFF-DRVSVNAKAPFFIIQQALSRLRDN--SRIINISSAAT
3bmqC           IINRAFGRCDVLVNNASAFYPTPLKTVETQ-VAELIGTNAIAPFLLT---MSFAQRQSNLSIVNLCDAMV
3bmnD           IINRAFGRCDVLVNNASAFYPTPLKTVETQ-VAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMV
3grkA           TLEKKWGKLDFLVHAIGFSDTGRYIDTSEANFTNTMLISVYSLTAVSRRAEKLMADGGYGKVMPNYNVMG
3bmeC           IINRAFGRCDVLVNNASYPTPLVGKTVETQ-VAELIGTNAIAPFLLT---MSFAQRQNLS-IVNLCDAMV
1fk8A           VLAKCSKGMDGLVLCAGLGP-------QTKVLGNVVSVNYFGATELMDAFLPALKK--------------
1fjhA           VLAKCSKGMDGLVLCAGLGP-------QTKVLGNVVSVNYFGATELMDAFLPALKK--------------
3bmoB           IINRAFGRCDVLVNNASYPTPLVGKTVETQ-VAELIGTNAIAPFLLT---MSFAQRQNLS-IVNLCDAMV
3bmnA           IINRAFGRCDVLVNNASAFYPTPLKTVETQ-VAELIGTNAIAPFLLTMSFAQ--RQSSNLSIVNLCDAMV
3bmiB           IINRAFGRCDVLVNNASYPTPLVGKTVETQ-VAELIGTNAIAPFLLTMSFAQ--RQSSNLSIVNLCDAMV
3bmfC           IINRAFGRCDVLVNNASYPTPLVGKTVETQ-VAELIGTNAIAPFLLT---MSFAQRQNLS-IVNLCDAMV
3bmfB           IINRAFGRCDVLVNNASYPTPLVGKTVETQ-VAELIGTNAIAPFLLT---MSFAQRQNLS-IVNLCDAMV
3grkB           TLEKKWGKLDFLVHAIGFSDTGRYIDTSEANFTNTMLISVYSLTAVSRRAEKLMADGGYGKVMPNYNVMG
3e9nC           KL-KNLDHVDTLVHAAG----------SVAEWHAHLDLNVIVPAELSRQLLPALR-----------AASG
3e9nA           KL-KNLDHVDTLVHAAG----------SVAEWHAHLDLNVIVPAELSRQLLPALR-----------AASG
3bmnB           IINRAFGRCDVLVNNASAFYPTPLKTVETQ-VAELIGTNAIAPFLLTMSFAQ-RQKSNLSIVNLCDAMVD
3k2eB           VLAEEWGSLDFVVHAVAFSDKNELKGVDTSL--GNFLTSMISCYSFTYIASKILTLSYYGKVVPHYNVMG
3grpA           VAEREMEGIDILVNNAGITVRMQDQDWD-----DVLAVNLTAASTLTRELIHSMMRRRYGRIINITSI--
3grkD           TLEKKWGKLDFLVHAIGFSDTGRYIDTSEANFTNTMLISVYSLTAVSRRAEKLMADGGYGKVMPNYNVMG
3f1kA           RIAVNYPRLDGVLHNAGL-----LGDVQNPQVWQDVQVNVNATF-LTQAXXXXXXKSDAGSLVFTSSSVG
1a4uA           LLKKIFDQLDILINGAGI--------LDDHQIERTIAINFTGLVNTTTAILDFWRKGGPGGIIANCSVTG
3grpD           VAEREMEGIDILVNNAGIDQ-----DWD-----DVLAVNLTAASTLTRELIHSMMRRRYGRIINITSI--
3grpB           VAEREMEGIDILVNNAGV----RMQDQD---WDDVLAVNLTAASTLTRELIHSMMRRRYGRIINITSI--
2z1nB           IRERDLGGADILVYSTGGPRPGRFMELGVEDWDESYRLLARSAVWVGRRAAEQMVEKGWGRMVYIGSVTL
2z1nA           IRERDLGGADILVYSTGGPRPGRFMELGVEDWDESYRLLARSAVWVGRRAAEQMVEKGWGRMVYIGSVTL


                         +         .         .         .         .         *         .:210
query           LVAMKYRGAYNASKYAIEGLTDTMRLELRDSNIFITSLNTGPITSKFRENSIKTITNVNYDSSVHKQQYE
1zemA           VKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPG-----------------------------
2japC           RVNVRNAAVYQATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDTELRGHITHTATKEMYESQIRKLQAQ
2japA           RVNVRNAAVYQATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDTELRGHITHTATKEMYESQIRKLQAQ
1iolA           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTHRFY
1bhsA           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTHRFY
1a27A           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTHRFY
2yz7A           LVASVNKSAYVAAKHGVVGLTKVTALENAGKGITCNAICPGWVRTPLVEKQIEAIS--------------
1fduD           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLEVLDRTDIHTFHRFYQYL
1ae1B           FSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVETAIK-----------------
1xr3B           KQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGPMAASVREVS-------------------
1x7hB           KQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGPMAASVREH--------------------
1w4zB           KQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGPMAASVREH--------------------
1w4zA           KQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGPMAASVREH--------------------
2rh4B           KQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGPMAASVREH--------------------
2rh4A           KQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGPMAASVREH--------------------
1x7gB           KQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGPMAASVRE---------------------
1x7gA           KQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGPMAASVREH--------------------
2rhrB           KQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGPMAASVREHT-------------------
1fduA           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGVLDRTDIHTFHRFYQYL
3csdB           KQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGPMAASVREHT-------------------
2bd0A           TKAFRHSSIYCMSKFGQRGLVETMRLYARKCNVRITDVQPGAV---------------------------
1xg5C           VLPLSVTHFYSATKYAVTALTEGLRQELREAQTHITCISPGVVETQF-----------------------
1xg5B           VLPLSVTHFYSATKYAVTALTEGLRQELREAQTHITCISPGVVETQF-----------------------
1xg5A           VLPLSVTHFYSATKYAVTALTEGLRQELREAQTHITCISPGVVETQF-----------------------
1fduC           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTHRFY
2rhrA           KQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGPMAASVREH--------------------
1ae1A           FSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILQK------------------------
2ae2A           ALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQ-----------------
1fduB           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFME---KVLVLDRTDIHTFHRFYQ
2ztmA           LVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRSPLVEKQISALAEKN-----------
1qyxA           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTSPEEVLDRT------DIHTFHRFYQ
1qyvA           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTSPEEVLDRT------DIHTFHRFYQ
1iy8A           IRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQLDPEN-----------
2c07A           LTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSISEQIKKNIISNI------------
2ae1A           ALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATQ------------------------
1jtvA           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTGSPEEVLDR-------TDIHTHRFY
3deyX           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTGSPEEVLDR-------TDIHTHRFY
1fdwA           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAGSPEEVLDRTDIH---TFHR--FY
2ztlA           LVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISALAEKN-----------
2uvdA           VTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIAT-------------------------
2ztmC           LVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRSPLVEKQISAL---------------
2q2wD           LVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDPLQAQHDLLAEKQPSL
2q2vC           LVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRLQAQHDLLAEKQPSL
1fdsA           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPV-----HTVLGSPEEVLDRTDIHTHRFY
2ztmD           LVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRSPLVEKQI------------------
1fdvB           LMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVTEVLDRTDIHTFHRFYQYLALSKQVFR
1xu9B           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
1xu9A           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
1xu7D           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
1xu7B           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
1xu7A           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
2rbeD           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
2rbeC           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
2rbeB           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
2rbeA           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
2irwC           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
2irwA           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
2iltA           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
3hfgA           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
3ey4C           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
3ey4A           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
3d5qB           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
3d4nB           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
3ch6E           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
3ch6D           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
3ch6B           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
3ch6A           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
3bzuB           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
3bzuA           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
3byzA           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
2belD           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
2belB           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
2belA           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
3czrA           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGVHMQAA-------
2ztvD           LVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQI------------------
2ztvC           LVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQI------------------
3hfgB           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIHMQAA-------
3d4nD           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIHMQAA-------
2q2qG           LVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQID-------DRAAPLQAQH
2ztmB           LVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRS-------------------------
1xu9C           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGI------------
2q2qE           LVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPL----------------VQKQIDD
1nffA           LAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGPMTDWVPEDIFQT----------------
3hfgC           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGI------------
1gegE           HVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPG-----------------------------
1gegA           HVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPG-----------------------------
3d4nC           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGI------------
3d4nA           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSIVHMQAA-------
3d3eB           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGI------------
3d3eA           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGI------------
2ztvB           LVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKT-------------------
1x1tA           LVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTLLSE---------------------
2q2qB           LVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGPLVQKQIDDRAGDPLQAQHDLLAEKQPSL
2ztuD           LVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPG-----------------------------
2ztuC           LVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPG-----------------------------
2ztuB           LVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPG-----------------------------
2ztuA           LVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPG-----------------------------
2q2wC           LVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQID-------DGGDPLQAQH
2q2vD           LVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDD-RQAQHDLLAEKQPSL
2q2qF           LVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLAQHDL------------------
3hfgD           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGM------------
2belC           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGM------------
1xu9D           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVS--------------
2q2wA           LVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQI------------------
2q2vB           LVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQI------------------
2q2vA           LVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQI------------------
2q2qC           LVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQI------------------
2q2qA           LVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQI------------------
2p68B           FTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPG-----------------------------
2p68A           FTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPG-----------------------------
3frjA           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVS--------------
3d5qD           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVS--------------
2q2qH           LVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPG-----------------------------
2ehdB           KNPFKGGAAYNASKFXXXXXXXXXMLDLREANVRVVNVLPGSVKLK------------------------
3d5qC           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVS----------------------------------
3d5qA           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVS----------------------------------
3bzuD           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDT---ETAMKAVSGIVHMQAAPKEE--
3bzuC           KVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVS----------------------------------
2zk7B           SIITKNASAYVTSKHAVIGLTKSIALD-------------------------------------------
1uznB           LWGIGNQANYAASKAGVIGMARSIARELSKANV-------------------------------------
1uznA           LWGIGNQANYAASKAGVIGMARSIARELSKANV-------------------------------------
1q7bB           TMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPG-----------------------------
1q7bA           TMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPG-----------------------------
2ehdA           KNPFKGGAAYNASKFXXXXXXXXXMLDLREANVRVVNVLPG-----------------------------
2dteA           SIITKNASAYVTSKHAVIGLTKSIALD-------------------------------------------
3f9iA           --GNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGKLNEKQREAIVQKI---------------
1q7cA           TMGNGGQANFAAAKAGLIGFSKSLAREVASRGITVNVVAPG-----------------------------
3g1tA           RQGRANWGAYATSKFATEGMMQVLADEYQNRSLRVNCINPGGTRTSMRASAFPT----------------
2cfcA           LVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMI---------------------------
2jahC           RVNVRNAAVYQATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDTELRGHITHTATK-EYESQIRKLQAQ
2jahA           RVNVRNAAVYQATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDTELRGHITHTATK-EYESQIRKLQAQ
3ezlA           QKGQFGQTNYSTAKAGIHGFTMSLAQEVATKGVTVNTVSPGYI---------------------------
1y5mA           KMTQPMIAPYSASKFALDGFFSTIRTELTKVNVSITLCVLGLIDTETAMKEISGIIN-------------
2d1yB           LFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIRT----------------
1nfrA           LAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPG-----------------------------
1uzlB           SWGIGNQANYAASKAGVIGMARSIARELSKANV-------------------------------------
1i01E           ------QANYAAAKAGLIGFSKSLAREVASRGITVNVVAPG-----------------------------
2et6A           LYGNFGQANYASAKSALLGFAETLAKEGAKYNI-------------------------------------
2d1yD           LFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIAT----------------
2d1yC           LFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATE------------------------
2d1yA           LFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATE------------------------
3cxrA           ELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGPQTAPLRE---------------------
1i01B           ----TGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPG-----------------------------
3gk3A           SRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVE---------------------
3gk3C           SRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPG-----------------------------
1cydA           HVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVN-------------------------------
3cxtA           ELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIAT-------------------------
1xseA           KITYPLIAPYSASKFALDGFFSTLRSEVNKVNVSITLCILGLIDT---ETAIKATSGIYLGPASPKEE--
1hdcA           LMGLALTSSYGASKWGVRGLSKLAAVELGTDRIRVNSVHPG-----------------------------
3g49A           KITYPLIAPYSASKFALDGFFSTLRSEVNKVNVSITLCILGLIDT---ETAIKATSGIYLGPASPKEE--
3dwfC           KITYPLIAPYSASKFALDGFFSTLRSEVNKVNVSITLCILGLIDT---ETAIKATSGIYLGPASPKEE--
3dwfB           KITYPLIAPYSASKFALDGFFSTLRSEVNKVNVSITLCILGLIDT---ETAIKATSGIYLGPASPKEE--
3dwfA           KITYPLIAPYSASKFALDGFFSTLRSEVNKVNVSITLCILGLIDT---ETAIKATSGIYLGPASPKEE--
3gk3B           SRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVE---------------------
3gk3D           SRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVE---------------------
1vl8B           EVTMPNISAYAASKGGVASLTKALAKEWGRYGIRVNVIAPGWYRTKMTE---------------------
1vl8A           EVTMPNISAYAASKGGVASLTKALAKEWGRYGIRVNVIAPGWYRTKMTE---------------------
1k2wA           RRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVV---------------------------
2b4qA           ISAMGEQAAYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSR------------------------
1spxA           LHATPDFPYYSIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVATGF-----------------------
1zbqA           IYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTI--------------------------------
2ph3A           ILGNPGQANYVASKAGLIGFTRAVAKEYAQRGITVNAVAPGFIETEMTE---------------------
3gz4B           RQGRANWGAYAASKFATEGMMQVLADEYQ-QRLRVNCINPGGTRTAMRASAFPT----------------
3gz4A           RQGRANWGAYAASKFATEGMMQVLADEYQ-QRLRVNCINPGGTRTAMRASAFPT----------------
1g6kA           KIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINT-------------------------
3ftpD           SAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDEQQTALKT----------------
3i3oG           YEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIGS-------------------------
3i3oF           YEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVSQFGSNVPMQR--
3i3oE           YEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVSQFGSNVPMQR--
3i3oC           YEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVSQFGSNVPMQR--
3i3oB           YEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVSQFGSNVPMQR--
3i3oA           YEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVSQFGSNVPMQR--
1geeA           KIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINT-------------------------
1gcoA           KIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINT-------------------------
1xhlA           PQAHSGYPYYACAKAALDQYTRCTAIDLIQHGVRVNSVSPGAVATGF-----------------------
3f5qA           RQGRANWGAYAASKFATEGMMQVLADEYQ-QRLRVNCINPGGTRQKLK----------------------
1xkqB           PQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVETGF-----------------------
1xkqA           PQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVETGF-----------------------
3ijrH           YEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPI---------------------------
3ijrF           YEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPI---------------------------
3ijrE           YEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPI---------------------------
3ijrB           YEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPI---------------------------
3ijrA           YEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPI---------------------------
3i3oH           YEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPI---------------------------
3gafH           ENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAI---------------------------
3gafG           ENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAI---------------------------
3gafF           ENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAI---------------------------
3gafE           ENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAI---------------------------
3gafD           ENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAI---------------------------
3gafC           ENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAI---------------------------
3gafB           ENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAI---------------------------
3gafA           ENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAI---------------------------
3f9iB           XXXPG-QANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKS-------------------------
1zjyA           FVGDPSLGAYNASKGAVRIMSKSAALDLKDYDVRVNTVHPGYI---------------------------
1rwbA           KIPWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINT-------------------------
1nxqA           FVGDPSLGAYNASKGAVRIMSKSAALDLKDYDVRVNTVHPGYI---------------------------
1i01A           TMAAAKAGLIGFSK--------------------------------------------------------
3f5qB           RQGRANWGAYAASKFATEGMMQVLADEYQ-QRLRVNCINPG-----------------------------
2ag5C           SVGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGN-------------
2ag5B           SVGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGN-------------
2ag5A           SVGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGN-------------
1fmcA           ENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAI---------------------------
1ahhA           ENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAI---------------------------
1yb1A           HVSVPFLLAYCSSKFAAVGFHKTLTDELQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMH
3i4fD           WI---YRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEATIQ-----------------
3i4fC           WI---YRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEATIQ-----------------
3i4fA           WI---YRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEATIQ-----------------
2zatA           YHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQ---------------------
1yb1B           HVSVPFLLAYCSSKFAAVGFHKTLTDELQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMH
1n5dA           VRALNECSPELQQKFKSETITEEELVGL--MNKFVEDTKNGVHRKEGWSDSTYGVTKIGV--SVLSRIYA
3ftpC           SAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIMTKEQQTALKT----------------
3f1lB           RQGRANWGAYAASKFATEGMMQVLADEYQ-QRLRVNCINPGGTRTAMRASAFPT----------------
3f1lA           RQGRANWGAYAASKFATEGMMQVLADEYQ-QRLRVNCINPGGTRTAMRASAFPT----------------
2zk7A           ----KNASAYVTSKHAVIGLTKSIALD-------------------------------------------
3gy0A           RQGRANWGAYAASKFATEGMMQVLADEYQ-QRLRVNCINPGGTRTAMRASAFPT----------------
3guyG           QQPKAQESTYCAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATEFWETSGKSLDTSSFMSA-------
1wmaA           VRALKSCSPELQQKFRSETITE------------------------------------------------
1o5iA           ISPIENLYTSNSARMALTGFLKTLSFEVAPYGITVNCVAPG-----------------------------
1i01F           -----------AAKAGLIGFSKSLAREVASRGITVNVVAPG-----------------------------
3guyD           QQPKAQESTYCAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATEFWETSGKSLSS-------------
3bhmA           VRALKSCSPELQQKFRSETITE------------------------------------------------
3ftpA           SAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPG-----------------------------
1edoA           LIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIAS-------------------------
2pfgA           VRALKSCSPELQQKFRSETITE------------------------------------------------
2hq1A           ------QANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGII---------------------------
3gvcD           QVAVGGTGAYGMSKAGIIQLSRITAAELRSSGI-------------------------------------
3gvcC           QVAVGGTGAYGMSKAGIIQLSRITAAELRSSGI-------------------------------------
3gvcB           QVAVGGTGAYGMSKAGIIQLSRITAAELRSSGI-------------------------------------
3gvcA           QVAVGGTGAYGMSKAGIIQLSRITAAELRSSGI-------------------------------------
3emkB           VTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIKDAIMGN--------------------
1gz6A           IYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTINAGSRTETVPEDLVEAL---------------
3f5sB           RQGRANWGAYAASKFATEGMMQVLADEYQ-QRLRVNCINPG-----------------------------
3f5sA           RQGRANWGAYAASKFATEGMMQVLADEYQ-QRLRVNCINPG-----------------------------
2b4qB           ISAMGEQAAYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSR------------------------
1ybvA           QAAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGI---------------------------
2ph3B           ILGNP--ANYVASKAGLIGFTRAVAKEYAQRGITVNAVIETEMTER------------------------
1i01D           -------ANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETALSDD--------------------
1g0oC           QAAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGI---------------------------
1g0oA           QAAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGI---------------------------
1g0nB           QAAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGI---------------------------
1dohB           QAAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGI---------------------------
1dohA           QAAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGI---------------------------
2pd6D           KVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGPMTQKVPQKVVDKITEM------------
1xq1A           SIYSATKGALNARNLACEWASDGIR---------------------------------------------
2pd6C           KVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGPMTQKVPQKVVDKITEM------------
2gdzA           LMPVAQQPVYCASKHGIVGFTRSAALNLMNSGVRLNAICPGFVNTAILES--------------------
2pd3A           --STKYMAHYNVAKAALESAVRYLAVDLGKHHIRVNALSAGPI---------------------------
1i01C           -------ANYAAAKAGLIGFSKSLAREVASRGITVNVVAPG-----------------------------
1gz6C           IYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTI--------------------------------
1gz6B           IYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTI--------------------------------
1i01H           -------ANYAAAKAGLIGFSKSLAREVASRGITVNVVAPG-----------------------------
1i01G           ---------YAAAKAGLIGFSKSLAREVASRGITVNVVAPG-----------------------------
3guyH           QQPKAQESTYCAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATEF-----------------------
3guyC           QQPKAQESTYCAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATEF-----------------------
2fwmX           HTPRIGMSAYGXXXXXXXXXXXXVGLELAGSGVRCNVVSPGSTRPQEIANTI------------------
2bgkA           FTAGEVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVS-------------------------------
2pd6B           KVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGPMTQKVPQKVVDKITEM------------
3ennA           VTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESKQKD---------------------
2pd6A           KVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMK----------------------
3guyA           QQPKAQESTYCAVKWAVKGLIESVRLELKGKPMKIIAVYPG-----------------------------
2ewmB           WLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAI--------------------------------
2ewmA           WLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAI--------------------------------
2ew8B           WLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAI--------------------------------
2ew8A           WLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAI--------------------------------
3emkA           VTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAMEKQKDAIMGNI------------
3bmeB           QPCMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3emkD           VTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIEEKQKD---------------------
3bmjD           DQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
1yxmD           FPLAVHSGAARAGVY---NLTKSLALEWACSGIRINCVAPGVIYSQ------------------------
1ulsC           -----YLGNLGQANYAVVGLTRTLALELGRWGIRVNTLAPGFIETKVREKAI------------------
3guyB           QQPKAQESTYCAVKWAVKGLIESVRLELKGKPMKIIAVYPG-----------------------------
3ennB           VTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESNEKQ---------------------
2wd7B           QPCMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3bmnC           QPCMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3bmeA           DQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
2vz0B           QPCMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
1ulsB           -----YLGNLGQANYAVVGLTRTLALELGRWGIRVNTLRTAKVPEKVREKAI------------------
1ulsA           -----YLGNLGQANYAVVGLTRTLALELGRWGIRVNTLRTAKVPEKVREKAI------------------
3grkG           V-----------AKAALEASVKYLAVDLGPQNIRVNAISAGPIKGDFR----------------------
3bmfD           DQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3bmdB           QPCMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
1yxmB           FPLAVHSGAARAGVY---NLTKSLALEWACSGIRINCVAPGVIYSQFFEGSFQKI---------------
2wd7C           DQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3bmoD           QPCMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3bmoC           QPCMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
1yxmA           FPLAVHSGAARAGVY---NLTKSLALEWACSGIRINCVAPGVIYSQ------------------------
2vz0A           DQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3iahA           RQGRANWGAYATSKFATEG--QVLADEYQNRSLRVNCINPG-----------------------------
3ennD           VTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPG-----------------------------
3ennC           VTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPG-----------------------------
3emkC           VTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPG-----------------------------
2c7vB           DQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
2c7vA           DQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3bmfA           DQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
2c7vD           DQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3bmqA           DQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3bmkC           QPCMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
2yw9H           IVTLTYYASYNVAKAALEASVRYLAYELGPKGVRVNAISAGPVFTKMYDRVAQT----------------
3iccA           RISLPDFIAY-STKGAI-NTTFTLAKQLGARGITVNAILPG-----------------------------
3bmqC           DQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3bmnD           DQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3grkA           V-----------AKAALEASVKYLAVDLGPQNIRVNAISAGPITGDFR----------------------
3bmeC           DQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
1fk8A           ----------------------------------------------------------------------
1fjhA           ----------------------------------------------------------------------
3bmoB           DQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3bmnA           DQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3bmiB           DQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3bmfC           DQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3bmfB           DQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3grkB           V-----------AKAALEASVKYLAVDLGPQNIRVNAISAGPIKTLAASGDFRYILKWN-----------
3e9nC           CVIYINNTIYAASKHALRGLADAFRKEEANNGIRVSTVSPGP----------------------------
3e9nA           CVIYINNTIYAASKHALRGLADAFRKEEANNGIRVSTVSPGP----------------------------
3bmnB           QPCMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPG-----------------------------
3k2eB           VC-----------KAALEASVKYLAVDLGKQQIRVNAISAGPVRSDF-----------------------
3grpA           -----GQTNYCAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKS-------------------------
3grkD           V-----------AKAALEASVKYLAVDLGPQNIRVNAISAGPI---------------------------
3f1kA           RQGRANWGAYAASKFATEGLADEYQQRLR-----VNCINPGGTRTAMRASAFPT----------------
1a4uA           FNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPG-----------------------------
3grpD           ------QTNYCAAKAGLIGFSKALAQEIASRNITVNCIAPG-----------------------------
3grpB           -----GQTNYCAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKS-------------------------
2z1nB           LRPWQDLALSNIMRLPVIGVVRTLALELAPHGVTVNAV--------------------------------
2z1nA           LRPWQDLALSNIMRLPVIGVVRTLALELAPHGVTVNAV--------------------------------


                         .         .         .         +         .         .         .:280
query           KILARQHKKVPFNEPAISVAKVVEKIINCDKPKPRYYITKxxxxxxxxxxxxxxxxxxxxxxxx
1zemA           ----------------------------------------------------------------
2japC           DI--------------------------------------------------------------
2japA           DI--------------------------------------------------------------
1iolA           QYLA--HSKQVFREAAQNVAEVFLTALRAPKPTLRYFTTE------------------------
1bhsA           QYLA--HSKQVFREAAQNVAEVFLTALRAPKPTLRYFTTE------------------------
1a27A           QYLA--HSKQVFREAAQNVAEVFLTALRAPKPTLRYFTTE------------------------
2yz7A           ----------------------------------------------------------------
1fduD           ALSKQVFREAAQNPE--EVAEVFLTALRAPKPTLRYFTTE------------------------
1ae1B           ----------------------------------------------------------------
1xr3B           ----------------------------------------------------------------
1x7hB           ----------------------------------------------------------------
1w4zB           ----------------------------------------------------------------
1w4zA           ----------------------------------------------------------------
2rh4B           ----------------------------------------------------------------
2rh4A           ----------------------------------------------------------------
1x7gB           ----------------------------------------------------------------
1x7gA           ----------------------------------------------------------------
2rhrB           ----------------------------------------------------------------
1fduA           ALSKQVFREAAQNPE--EVAEVFLTALRAPKPTLRYFTTE------------------------
3csdB           ----------------------------------------------------------------
2bd0A           ----------------------------------------------------------------
1xg5C           ----------------------------------------------------------------
1xg5B           ----------------------------------------------------------------
1xg5A           ----------------------------------------------------------------
1fduC           QYLAL--SKQVFREAAQNVAEVFLTALRAPKPTLRYFTTE------------------------
2rhrA           ----------------------------------------------------------------
1ae1A           ----------------------------------------------------------------
2ae2A           ----------------------------------------------------------------
1fduB           YLLSKQVFREAAQNPE-EVAEVFLTALRAPKPTLRYFTTE------------------------
2ztmA           ----------------------------------------------------------------
1qyxA           YL---AHSKQVFREAAQNVAEVFLTALRAPKPTLRYFTTE------------------------
1qyvA           YL---AHSKQVFREAAQNVAEVFLTALRAPKPTLRYFTTE------------------------
1iy8A           ----------------------------------------------------------------
2c07A           ----------------------------------------------------------------
2ae1A           ----------------------------------------------------------------
1jtvA           QYLA--HSKQVFREAAQNVAEVFLTALRAPKPTLRYFTTE------------------------
3deyX           QYLA--HSKQVFREAAQNVAEVFLTALRAPKPTLRYFTTE------------------------
1fdwA           QYLA-QSKQV-FREAAQNVAEVFLTALRAPKPTLRYFTTE------------------------
2ztlA           ----------------------------------------------------------------
2uvdA           ----------------------------------------------------------------
2ztmC           ----------------------------------------------------------------
2q2wD           AFVTPEH---------------------------------------------------------
2q2vC           AFVTPEH---------------------------------------------------------
1fdsA           QYLA--HSKQVFREAAQNVAEVFLTALRAPKPTLRYFTTE------------------------
2ztmD           ----------------------------------------------------------------
1fdvB           E--AAQNPE--------EVAEVFLTALRAPKPTLRYFTTE------------------------
1xu9B           ----------------------------------------------------------------
1xu9A           ----------------------------------------------------------------
1xu7D           ----------------------------------------------------------------
1xu7B           ----------------------------------------------------------------
1xu7A           ----------------------------------------------------------------
2rbeD           ----------------------------------------------------------------
2rbeC           ----------------------------------------------------------------
2rbeB           ----------------------------------------------------------------
2rbeA           ----------------------------------------------------------------
2irwC           ----------------------------------------------------------------
2irwA           ----------------------------------------------------------------
2iltA           ----------------------------------------------------------------
3hfgA           ----------------------------------------------------------------
3ey4C           ----------------------------------------------------------------
3ey4A           ----------------------------------------------------------------
3d5qB           ----------------------------------------------------------------
3d4nB           ----------------------------------------------------------------
3ch6E           ----------------------------------------------------------------
3ch6D           ----------------------------------------------------------------
3ch6B           ----------------------------------------------------------------
3ch6A           ----------------------------------------------------------------
3bzuB           ----------------------------------------------------------------
3bzuA           ----------------------------------------------------------------
3byzA           ----------------------------------------------------------------
2belD           ----------------------------------------------------------------
2belB           ----------------------------------------------------------------
2belA           ----------------------------------------------------------------
3czrA           ----------------------------------------------------------------
2ztvD           ----------------------------------------------------------------
2ztvC           ----------------------------------------------------------------
3hfgB           ----------------------------------------------------------------
3d4nD           ----------------------------------------------------------------
2q2qG           DLLAEKQPSLAFVTP-------------------------------------------------
2ztmB           ----------------------------------------------------------------
1xu9C           ----------------------------------------------------------------
2q2qE           RALQAQHDLLAEKQPSLA----------------------------------------------
1nffA           ----------------------------------------------------------------
3hfgC           ----------------------------------------------------------------
1gegE           ----------------------------------------------------------------
1gegA           ----------------------------------------------------------------
3d4nC           ----------------------------------------------------------------
3d4nA           ----------------------------------------------------------------
3d3eB           ----------------------------------------------------------------
3d3eA           ----------------------------------------------------------------
2ztvB           ----------------------------------------------------------------
1x1tA           ----------------------------------------------------------------
2q2qB           AFVTPEH---------------------------------------------------------
2ztuD           ----------------------------------------------------------------
2ztuC           ----------------------------------------------------------------
2ztuB           ----------------------------------------------------------------
2ztuA           ----------------------------------------------------------------
2q2wC           DLLAEKQPSLAFVTP-------------------------------------------------
2q2vD           AFVTPEH---------------------------------------------------------
2q2qF           ----------------------------------------------------------------
3hfgD           ----------------------------------------------------------------
2belC           ----------------------------------------------------------------
1xu9D           ----------------------------------------------------------------
2q2wA           ----------------------------------------------------------------
2q2vB           ----------------------------------------------------------------
2q2vA           ----------------------------------------------------------------
2q2qC           ----------------------------------------------------------------
2q2qA           ----------------------------------------------------------------
2p68B           ----------------------------------------------------------------
2p68A           ----------------------------------------------------------------
3frjA           ----------------------------------------------------------------
3d5qD           ----------------------------------------------------------------
2q2qH           ----------------------------------------------------------------
2ehdB           ----------------------------------------------------------------
3d5qC           ----------------------------------------------------------------
3d5qA           ----------------------------------------------------------------
3bzuD           ----------------------------------------------------------------
3bzuC           ----------------------------------------------------------------
2zk7B           ----------------------------------------------------------------
1uznB           ----------------------------------------------------------------
1uznA           ----------------------------------------------------------------
1q7bB           ----------------------------------------------------------------
1q7bA           ----------------------------------------------------------------
2ehdA           ----------------------------------------------------------------
2dteA           ----------------------------------------------------------------
3f9iA           ----------------------------------------------------------------
1q7cA           ----------------------------------------------------------------
3g1tA           ----------------------------------------------------------------
2cfcA           ----------------------------------------------------------------
2jahC           DI--------------------------------------------------------------
2jahA           DI--------------------------------------------------------------
3ezlA           ----------------------------------------------------------------
1y5mA           ----------------------------------------------------------------
2d1yB           ----------------------------------------------------------------
1nfrA           ----------------------------------------------------------------
1uzlB           ----------------------------------------------------------------
1i01E           ----------------------------------------------------------------
2et6A           ----------------------------------------------------------------
2d1yD           ----------------------------------------------------------------
2d1yC           ----------------------------------------------------------------
2d1yA           ----------------------------------------------------------------
3cxrA           ----------------------------------------------------------------
1i01B           ----------------------------------------------------------------
3gk3A           ----------------------------------------------------------------
3gk3C           ----------------------------------------------------------------
1cydA           ----------------------------------------------------------------
3cxtA           ----------------------------------------------------------------
1xseA           ----------------------------------------------------------------
1hdcA           ----------------------------------------------------------------
3g49A           ----------------------------------------------------------------
3dwfC           ----------------------------------------------------------------
3dwfB           ----------------------------------------------------------------
3dwfA           ----------------------------------------------------------------
3gk3B           ----------------------------------------------------------------
3gk3D           ----------------------------------------------------------------
1vl8B           ----------------------------------------------------------------
1vl8A           ----------------------------------------------------------------
1k2wA           ----------------------------------------------------------------
2b4qA           ----------------------------------------------------------------
1spxA           ----------------------------------------------------------------
1zbqA           ----------------------------------------------------------------
2ph3A           ----------------------------------------------------------------
3gz4B           ----------------------------------------------------------------
3gz4A           ----------------------------------------------------------------
1g6kA           ----------------------------------------------------------------
3ftpD           ----------------------------------------------------------------
3i3oG           ----------------------------------------------------------------
3i3oF           ----------------------------------------------------------------
3i3oE           ----------------------------------------------------------------
3i3oC           ----------------------------------------------------------------
3i3oB           ----------------------------------------------------------------
3i3oA           ----------------------------------------------------------------
1geeA           ----------------------------------------------------------------
1gcoA           ----------------------------------------------------------------
1xhlA           ----------------------------------------------------------------
3f5qA           ----------------------------------------------------------------
1xkqB           ----------------------------------------------------------------
1xkqA           ----------------------------------------------------------------
3ijrH           ----------------------------------------------------------------
3ijrF           ----------------------------------------------------------------
3ijrE           ----------------------------------------------------------------
3ijrB           ----------------------------------------------------------------
3ijrA           ----------------------------------------------------------------
3i3oH           ----------------------------------------------------------------
3gafH           ----------------------------------------------------------------
3gafG           ----------------------------------------------------------------
3gafF           ----------------------------------------------------------------
3gafE           ----------------------------------------------------------------
3gafD           ----------------------------------------------------------------
3gafC           ----------------------------------------------------------------
3gafB           ----------------------------------------------------------------
3gafA           ----------------------------------------------------------------
3f9iB           ----------------------------------------------------------------
1zjyA           ----------------------------------------------------------------
1rwbA           ----------------------------------------------------------------
1nxqA           ----------------------------------------------------------------
1i01A           ----------------------------------------------------------------
3f5qB           ----------------------------------------------------------------
2ag5C           ----------------------------------------------------------------
2ag5B           ----------------------------------------------------------------
2ag5A           ----------------------------------------------------------------
1fmcA           ----------------------------------------------------------------
1ahhA           ----------------------------------------------------------------
1yb1A           GILTEQ--KMIFIPSSIAFLTTLERIL-------------------------------------
3i4fD           ----------------------------------------------------------------
3i4fC           ----------------------------------------------------------------
3i4fA           ----------------------------------------------------------------
2zatA           ----------------------------------------------------------------
1yb1B           GILTEQ--KMIFIPSSIAFLTTLERIL-------------------------------------
1n5dA           RKLREQ----------------------------------------------------------
3ftpC           ----------------------------------------------------------------
3f1lB           ----------------------------------------------------------------
3f1lA           ----------------------------------------------------------------
2zk7A           ----------------------------------------------------------------
3gy0A           ----------------------------------------------------------------
3guyG           ----------------------------------------------------------------
1wmaA           ----------------------------------------------------------------
1o5iA           ----------------------------------------------------------------
1i01F           ----------------------------------------------------------------
3guyD           ----------------------------------------------------------------
3bhmA           ----------------------------------------------------------------
3ftpA           ----------------------------------------------------------------
1edoA           ----------------------------------------------------------------
2pfgA           ----------------------------------------------------------------
2hq1A           ----------------------------------------------------------------
3gvcD           ----------------------------------------------------------------
3gvcC           ----------------------------------------------------------------
3gvcB           ----------------------------------------------------------------
3gvcA           ----------------------------------------------------------------
3emkB           ----------------------------------------------------------------
1gz6A           ----------------------------------------------------------------
3f5sB           ----------------------------------------------------------------
3f5sA           ----------------------------------------------------------------
2b4qB           ----------------------------------------------------------------
1ybvA           ----------------------------------------------------------------
2ph3B           ----------------------------------------------------------------
1i01D           ----------------------------------------------------------------
1g0oC           ----------------------------------------------------------------
1g0oA           ----------------------------------------------------------------
1g0nB           ----------------------------------------------------------------
1dohB           ----------------------------------------------------------------
1dohA           ----------------------------------------------------------------
2pd6D           ----------------------------------------------------------------
1xq1A           ----------------------------------------------------------------
2pd6C           ----------------------------------------------------------------
2gdzA           ----------------------------------------------------------------
2pd3A           ----------------------------------------------------------------
1i01C           ----------------------------------------------------------------
1gz6C           ----------------------------------------------------------------
1gz6B           ----------------------------------------------------------------
1i01H           ----------------------------------------------------------------
1i01G           ----------------------------------------------------------------
3guyH           ----------------------------------------------------------------
3guyC           ----------------------------------------------------------------
2fwmX           ----------------------------------------------------------------
2bgkA           ----------------------------------------------------------------
2pd6B           ----------------------------------------------------------------
3ennA           ----------------------------------------------------------------
2pd6A           ----------------------------------------------------------------
3guyA           ----------------------------------------------------------------
2ewmB           ----------------------------------------------------------------
2ewmA           ----------------------------------------------------------------
2ew8B           ----------------------------------------------------------------
2ew8A           ----------------------------------------------------------------
3emkA           ----------------------------------------------------------------
3bmeB           ----------------------------------------------------------------
3emkD           ----------------------------------------------------------------
3bmjD           ----------------------------------------------------------------
1yxmD           ----------------------------------------------------------------
1ulsC           ----------------------------------------------------------------
3guyB           ----------------------------------------------------------------
3ennB           ----------------------------------------------------------------
2wd7B           ----------------------------------------------------------------
3bmnC           ----------------------------------------------------------------
3bmeA           ----------------------------------------------------------------
2vz0B           ----------------------------------------------------------------
1ulsB           ----------------------------------------------------------------
1ulsA           ----------------------------------------------------------------
3grkG           ----------------------------------------------------------------
3bmfD           ----------------------------------------------------------------
3bmdB           ----------------------------------------------------------------
1yxmB           ----------------------------------------------------------------
2wd7C           ----------------------------------------------------------------
3bmoD           ----------------------------------------------------------------
3bmoC           ----------------------------------------------------------------
1yxmA           ----------------------------------------------------------------
2vz0A           ----------------------------------------------------------------
3iahA           ----------------------------------------------------------------
3ennD           ----------------------------------------------------------------
3ennC           ----------------------------------------------------------------
3emkC           ----------------------------------------------------------------
2c7vB           ----------------------------------------------------------------
2c7vA           ----------------------------------------------------------------
3bmfA           ----------------------------------------------------------------
2c7vD           ----------------------------------------------------------------
3bmqA           ----------------------------------------------------------------
3bmkC           ----------------------------------------------------------------
2yw9H           ----------------------------------------------------------------
3iccA           ----------------------------------------------------------------
3bmqC           ----------------------------------------------------------------
3bmnD           ----------------------------------------------------------------
3grkA           ----------------------------------------------------------------
3bmeC           ----------------------------------------------------------------
1fk8A           ----------------------------------------------------------------
1fjhA           ----------------------------------------------------------------
3bmoB           ----------------------------------------------------------------
3bmnA           ----------------------------------------------------------------
3bmiB           ----------------------------------------------------------------
3bmfC           ----------------------------------------------------------------
3bmfB           ----------------------------------------------------------------
3grkB           ----------------------------------------------------------------
3e9nC           ----------------------------------------------------------------
3e9nA           ----------------------------------------------------------------
3bmnB           ----------------------------------------------------------------
3k2eB           ----------------------------------------------------------------
3grpA           ----------------------------------------------------------------
3grkD           ----------------------------------------------------------------
3f1kA           ----------------------------------------------------------------
1a4uA           ----------------------------------------------------------------
3grpD           ----------------------------------------------------------------
3grpB           ----------------------------------------------------------------
2z1nB           ----------------------------------------------------------------
2z1nA           ----------------------------------------------------------------