[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:ompH

[Show Plain Result]

#ERROR : Can't open dsspfile "1sg2C.bssp"
#ERROR : Can't open dsspfile "1sg2A.bssp"

## Summary of PDB Search
:167
    6e-10  27%  1sg2C  [f.48.1] SEVENTEEN KILODALTON PROTEIN
    7e-10  27%  1sg2A  [f.48.1] SEVENTEEN KILODALTON PROTEIN
:167

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxADTKIAVVNPVEIFNDSDLGSVSVKKLENDLKPDATKLKQEQDNIMQQMKT
1sg2C           -------------------AADKIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKK
1sg2A           ----------------------KIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKK


                         .         .         *         .         .         .         .:140
query           LQDNSATMTKSELDKKXXXXXXXXXNFAEKARILQQKEYTAKDKLSKKFQASFDKAVQTIAKQKNYNVVL
1sg2C           LQSMKAGSDRTKLEK---DVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVV
1sg2A           LQSMKAGSDRTKLEK---DVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVV


                         +         .         .         .         .         *         .:210
query           TTQALAYVNNVDDISSQVVExxxxxxx
1sg2C           DANAVAYSSDVKDITADVLK-------
1sg2A           DANAVAYSSDVKDITADVLK-------