[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:rnc

[Show Plain Result]

#ERROR : Can't open dsspfile "1yywC.bssp"
#ERROR : Can't open dsspfile "1yywA.bssp"
#ERROR : Can't open dsspfile "1yykA.bssp"
#ERROR : Can't open dsspfile "2nugB.bssp"
#ERROR : Can't open dsspfile "2nueB.bssp"
#ERROR : Can't open dsspfile "2nueA.bssp"
#ERROR : Can't open dsspfile "2nugA.bssp"
#ERROR : Can't open dsspfile "1yz9B.bssp"
#ERROR : Can't open dsspfile "1yz9A.bssp"
#ERROR : Can't open dsspfile "1yyoB.bssp"
#ERROR : Can't open dsspfile "1rc7A.bssp"
#ERROR : Can't open dsspfile "2ez6A.bssp"
#ERROR : Can't open dsspfile "1o0wB.bssp"
#ERROR : Can't open dsspfile "1o0wA.bssp"
#ERROR : Can't open dsspfile "2a11A.bssp"
#ERROR : Can't open dsspfile "1jfzB.bssp"
#ERROR : Can't open dsspfile "1jfzA.bssp"
#ERROR : Can't open dsspfile "1i4sA.bssp"
#ERROR : Can't open dsspfile "3c4tA.bssp"
#ERROR : Can't open dsspfile "2eb1C.bssp"
#ERROR : Can't open dsspfile "2eb1B.bssp"
#ERROR : Can't open dsspfile "2eb1A.bssp"
#ERROR : Can't open dsspfile "3c4bA.bssp"
#ERROR : Can't open dsspfile "2fflA.bssp"
#ERROR : Can't open dsspfile "2fflC.bssp"
#ERROR : Can't open dsspfile "2fflB.bssp"
#ERROR : Can't open dsspfile "2fflD.bssp"
#ERROR : Can't open dsspfile "2cpnA.bssp"
#ERROR : Can't open dsspfile "1di2A.bssp"

## Summary of PDB Search
:230
    3e-31  40%  1yywC  [x.x.x] RIBONUCLEASE III
    3e-31  40%  1yywA  [x.x.x] RIBONUCLEASE III
    3e-31  40%  1yykA  [x.x.x] RIBONUCLEASE III
    3e-31  40%  2nugB  [x.x.x] RIBONUCLEASE III
    3e-31  40%  2nueB  [x.x.x] RIBONUCLEASE III
    3e-31  40%  2nueA  [x.x.x] RIBONUCLEASE III
    5e-31  40%  2nugA  [x.x.x] RIBONUCLEASE III
    6e-31  39%  1yz9B  [x.x.x] RIBONUCLEASE III
    6e-31  39%  1yz9A  [x.x.x] RIBONUCLEASE III
    8e-31  39%  1yyoB  [x.x.x] RIBONUCLEASE III
    8e-31  39%  1rc7A  [a.149.1 - d.50.1] RIBONUCLEASE III
    1e-30  39%  2ez6A  [x.x.x] RIBONUCLEASE III
    8e-25  35%  1o0wB  [a.149.1 - d.50.1] RIBONUCLEASE III
    8e-25  35%  1o0wA  [a.149.1 - d.50.1] RIBONUCLEASE III
    3e-18  40%  2a11A  [x.x.x] RIBONUCLEASE III
    3e-18  44%  1jfzB  [a.149.1] RIBONUCLEASE III
    3e-18  44%  1jfzA  [a.149.1] RIBONUCLEASE III
    3e-18  44%  1i4sA  [a.149.1] RIBONUCLEASE III
    3e-16  32%  3c4tA  [x.x.x] ENDORIBONUCLEASE DICER
    3e-15  34%  2eb1C  [x.x.x] ENDORIBONUCLEASE DICER
    3e-15  34%  2eb1B  [x.x.x] ENDORIBONUCLEASE DICER
    3e-15  34%  2eb1A  [x.x.x] ENDORIBONUCLEASE DICER
    5e-15  33%  3c4bA  [x.x.x] ENDORIBONUCLEASE DICER
    1e-08  32%  2fflA  [x.x.x] DICER
    3e-08  33%  2fflC  [x.x.x] DICER
    3e-08  32%  2fflB  [x.x.x] DICER
    3e-07  33%  2fflD  [x.x.x] DICER
    9e-06  35%  2cpnA  [x.x.x] TAR RNA-BINDING PROTEIN 2
    4e-05  32%  1di2A  [d.50.1] DOUBLE STRANDED RNA BINDING PROTEIN A
:230

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVPEYSRFYNILGYNFKDYTLLIRALTHRSKTKKNYERLEFLGDSVLSFVIAEVLYKQFTDLAEGKLSQL
1yywC           -----------LGYTFKDKSLLEKALTHVSYSKKHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPL
1yywA           -----------LGYTFKDKSLLEKALTHVSYSKKHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPL
1yykA           -----------LGYTFKDKSLLEKALTHVSYSKKHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPL
2nugB           -----------LGYTFKDKSLLEKALTHVSYSKKHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPL
2nueB           -----------LGYTFKDKSLLEKALTHVSYSKKHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPL
2nueA           -----------LGYTFKDKSLLEKALTHVSYSKKHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPL
2nugA           -----------LGYTFKDKSLLEKALTHVSYSKKHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPL
1yz9B           -----------LGYTFKDKSLLEKALTHVSYSKKHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPL
1yz9A           -----------LGYTFKDKSLLEKALTHVSYSKKHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPL
1yyoB           -----------LGYTFKDKSLLEKALTHVSYSKKHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPL
1rc7A           -----------LGYTFKDKSLLEKALTHVSYSKKHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPL
2ez6A           -----------LGYTFKDKSLLEKALTHVSYSKKHYETLEFLGNALVNFFIVDLLVQYSPNKREGFLSPL
1o0wB           -------FQKETGINFKNEELLFRALCHSSKDVESNEKLEFLGDAVLELFVCEILYKKYPEAEVGDLARV
1o0wA           -------FQKETGINFKNEELLFRALCHSSKDVESNEKLEFLGDAVLELFVCEILYKKYPEAEVGDLARV
2a11A           -----------LGVDLPD-ELLSLALTHRSYAYENNERLEFLGDAVLGLTITDALFHRHPDRSEGDLAKL
1jfzB           -----------LGYTFKDKSLLEKALTHVSYSKKHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPL
1jfzA           -----------LGYTFKDKSLLEKALTHVSYSKKHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPL
1i4sA           -----------LGYTFKDKSLLEKALTHVSYSKKHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPL
3c4tA           LISGFETFEKKINYRFKNKAYLLQAFTHASNTITDYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDL
2eb1C           LISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDL
2eb1B           LISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDL
2eb1A           LISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDL
3c4bA           LISGFETFEKKINYRFKNKAYLLQAFTHASNTITDYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDL
2fflA           -----------------------------------FQRLELLGDAVLGFIVTARLLCLFPDASVGTLVEL
2fflC           -----------------------------------FQRLELLGDAVLGFIVTARLLCLFPDASVGTLVEL
2fflB           -----------------------------------FQRLELLGDAVLGFIVTARLLCLFPDASVGTLVEL
2fflD           -----------------------------------FQRLELLGDAVLGFIVTARLLCLFPDASVGTLVEL
2cpnA           ----------------------------------------------------------------------
1di2A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RSKLVKGTTLAQLASSLKMDEYIILGASEQGGHKREKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPI
1yywC           KAYLISEEFFNLLAQKLELHKFIRI----KRGKINETIIGDVFEALWAAVYIDSDANFTRELFYKLFEDI
1yywA           KAYLISEEFFNLLAQKLELHKFIRI----KRGKINETIIGDVFEALWAAVYIDSDANFTRELFYKLFEDI
1yykA           KAYLISEEFFNLLAQKLELHKFIRI----KRGKINETIIGDVFEALWAAVYIDSDANFTRELFYKLFEDI
2nugB           KAYLISEEFFNLLAQKLELHKFIRI----KRGKINETIIGDVFEALWAAVYIDSDANFTRELFYKLFEDI
2nueB           KAYLISEEFFNLLAQKLELHKFIRI----KRGKINETIIGDVFEALWAAVYIDSDANFTRELFYKLFEDI
2nueA           KAYLISEEFFNLLAQKLELHKFIRI----KRGKINETIIGDVFEALWAAVYIDSDANFTRELFYKLFEDI
2nugA           KAYLISEEFFNLLAQKLELHKFIRI----KRGKINETIIGDVFEALWAAVYIDSDANFTRELFYKLFEDI
1yz9B           KAYLISEEFFNLLAQKLELHKFIRI----KRGKINETIIGDVFQALWAAVYIDSDANFTRELFYKLFEDI
1yz9A           KAYLISEEFFNLLAQKLELHKFIRI----KRGKINETIIGDVFQALWAAVYIDSDANFTRELFYKLFEDI
1yyoB           KAYLISEEFFNLLAQKLELHKFIRI----KRGKINETIIGDVFKALWAAVYIDSDANFTRELFYKLFEDI
1rc7A           KAYLISEEFFNLLAQKLELHKFIRI----KRGKINETIIGDVFKALWAAVYIDSDANFTRELFYKLFEDI
2ez6A           KAYLISEEFFNLLAQKLELHKFIRI----KRGKINETIIGDVFEALWAAVYIDSDANFTRELFYKLFEDI
1o0wB           KSAAASEEVLAMVSRKMNLGKFLFLGKGEEGGRDRDSILADAFEALLAAIYLDQGYEKIKELFEQEFEFY
1o0wA           KSAAASEEVLAMVSRKMNLGKFLFLGKGEEGGRDRDSILADAFEALLAAIYLDQGYEKIKELFEQEFEFY
2a11A           RASVVNTQALADVARRLGLGVHVLLGRGETGGADKSSILADGMESLLGAIYLQHGMEKAREVILRLFGPL
1jfzB           KAYLISEEFFNLLAQKLELHKFIRI----KRGKINETIIGDVFEALWAAVYIDS----------------
1jfzA           KAYLISEEFFNLLAQKLELHKFIRI----KRGKINETIIGDVFEALWAAVYIDS----------------
1i4sA           KAYLISEEFFNLLAQKLELHKFIRI----KRGKINETIIGDVFEALWAAVYIDS----------------
3c4tA           RSALVNNTIFASLAVKYDYHKYFKAVSPEEEDIEVPKAMGDIFESLAGAIYMDSGMSL--EVVWQVYYPM
2eb1C           RSALVNNTIFASLAVKYDYHKYFVQFQLEKEDIEVPKAMGDIFESLAGAIYMDSGMSTVWQVYYPMMRPL
2eb1B           RSALVNNTIFASLAVKYDYHKYFVQFQLEKEDIEVPKAMGDIFESLAGAIYMDSGMSTVWQVYYPMMRPL
2eb1A           RSALVNNTIFASLAVKYDYHKYFVQFQLEKEDIEVPKAMGDIFESLAGAIYMDSGMSTVWQVYYPMMRPL
3c4bA           RSALVNNTIFASLAVKYDYHKYFKAVSPELFHEKNEEDIEDIFESLAGAIYDSGSLEVVWQVY--YPQPL
2fflA           KMELVRNEALNYLVQTLGLPQ-----LAEFSNNLKSKTWADMYEEIVGSIF-------------------
2fflC           KMELVRNEALNYLVQT--------LGLPQLAEFSKSKTWADMYEEIVGSIF-------------------
2fflB           KMELVRNEALNYLVQTLGLPQ-----LAENNLVAKSKTWADMYEEIVGSIF-------------------
2fflD           KMELVRNEALNYLVQTLGLPQLA----------EFSKTWADMYEEIVGSIF-------------------
2cpnA           ----------------------------------------------------------------------
1di2A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ISSINLDTIKVKDSKSKLQEILLQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKAE
1yywC           LSAIKEGRVK-KDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKE--YRTLGEGKSKKEAE
1yywA           LSAIKEGRVK-KDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKE--YRTLGEGKSKKEAE
1yykA           LSAIKEGRVK-KDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKE--YRTLGEGKSKKEAE
2nugB           LSAIKEGRVK-KDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKE--YRTLGEGKSKKEAE
2nueB           LSAIKEGRVK-KDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKE--YRTLGEGKSKKEAE
2nueA           LSAIKEGRVK-KDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKE--YRTLGEGKSKKEAE
2nugA           LSAIKEGRVK-KDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKE--YRTLGEGKSKKEAE
1yz9B           LSAIKEGRVK-KDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKE--YRTLGEGKSKKEAE
1yz9A           LSAIKEGRVK-KDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKE--YRTLGEGKSKKEAE
1yyoB           LSAIKEGRVK-KDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKE--YRTLGEGKSKKEAE
1rc7A           LSAIKEGRVK-KDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKE--YRTLGEGKSKKEAE
2ez6A           LSAIKEGRVK-KDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKE--YRTLGEGKSKKEAE
1o0wB           IEKI-MKGEMLFDYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVV----------------------
1o0wA           IEKI-MKGEMLFDYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVV----------------------
2a11A           LDA-------------------------------------------------------------------
1jfzB           ----------------------------------------------------------------------
1jfzA           ----------------------------------------------------------------------
1i4sA           ----------------------------------------------------------------------
3c4tA           MQPL-IEKFSANVPRSPVRELL------------------------------------------------
2eb1C           IEKFS-----------------------------------------------------------------
2eb1B           IEKFS-----------------------------------------------------------------
2eb1A           IEKFS-----------------------------------------------------------------
3c4bA           IEKFSANV-----PRSPVRELLEEPETAKFSPAERTYDGK------------------------------
2fflA           ----------------------------------------------------------------------
2fflC           ----------------------------------------------------------------------
2fflB           ----------------------------------------------------------------------
2fflD           ----------------------------------------------------------------------
2cpnA           -----------------LQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCVERFIEI---GSGTSKKLAK
1di2A           -----------------LQELAVQKGWRLPEYTVAQESGPPHKREFTITC--RVETFVETGSGTSKQVAK


                         .         .         .         +         .         .         .:280
query           QKTAEKMIEMLSQxxxxxxx
1yywC           QRAAEELIKLLEE-------
1yywA           QRAAEELIKLLEE-------
1yykA           QRAAEELIKLLEE-------
2nugB           QRAAEELIKLLEE-------
2nueB           QRAAEELIKLLEE-------
2nueA           QRAAEELIKLLEE-------
2nugA           QRAAEELIKLL---------
1yz9B           QRAAEELIKLLEE-------
1yz9A           QRAAEELIKLLEE-------
1yyoB           QRAAEELIKLLEE-------
1rc7A           QRAAEELIKLLEE-------
2ez6A           QRAAEELIKLLEE-------
1o0wB           --------------------
1o0wA           --------------------
2a11A           --------------------
1jfzB           --------------------
1jfzA           --------------------
1i4sA           --------------------
3c4tA           --------------------
2eb1C           --------------------
2eb1B           --------------------
2eb1A           --------------------
3c4bA           --------------------
2fflA           --------------------
2fflC           --------------------
2fflB           --------------------
2fflD           --------------------
2cpnA           RNAAAKMLLRVS--------
1di2A           RVAAEKLL------------