[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:trpS

[Show Plain Result]

#ERROR : Can't open dsspfile "2el7B.bssp"
#ERROR : Can't open dsspfile "2el7A.bssp"
#ERROR : Can't open dsspfile "1m83A.bssp"
#ERROR : Can't open dsspfile "1i6mA.bssp"
#ERROR : Can't open dsspfile "1d2rA.bssp"
#ERROR : Can't open dsspfile "2g36A.bssp"
#ERROR : Can't open dsspfile "1i6kA.bssp"
#ERROR : Can't open dsspfile "3fhjF.bssp"
#ERROR : Can't open dsspfile "3fhjE.bssp"
#ERROR : Can't open dsspfile "3fhjA.bssp"
#ERROR : Can't open dsspfile "3fhjD.bssp"
#ERROR : Can't open dsspfile "3fhjB.bssp"
#ERROR : Can't open dsspfile "3fhjC.bssp"
#ERROR : Can't open dsspfile "3fi0I.bssp"
#ERROR : Can't open dsspfile "2yy5B.bssp"
#ERROR : Can't open dsspfile "3fi0D.bssp"
#ERROR : Can't open dsspfile "3fi0G.bssp"
#ERROR : Can't open dsspfile "2yy5A.bssp"
#ERROR : Can't open dsspfile "3fi0F.bssp"
#ERROR : Can't open dsspfile "3fi0A.bssp"
#ERROR : Can't open dsspfile "3fi0K.bssp"
#ERROR : Can't open dsspfile "3fi0B.bssp"
#ERROR : Can't open dsspfile "2yy5C.bssp"
#ERROR : Can't open dsspfile "3fi0P.bssp"
#ERROR : Can't open dsspfile "1yi8B.bssp"
#ERROR : Can't open dsspfile "3fi0R.bssp"
#ERROR : Can't open dsspfile "3fi0E.bssp"
#ERROR : Can't open dsspfile "2cybB.bssp"
#ERROR : Can't open dsspfile "2cybA.bssp"
#ERROR : Can't open dsspfile "1zh0A.bssp"
#ERROR : Can't open dsspfile "2ag6A.bssp"
#ERROR : Can't open dsspfile "1zh6A.bssp"
#ERROR : Can't open dsspfile "1h3fB.bssp"
#ERROR : Can't open dsspfile "1h3fA.bssp"
#ERROR : Can't open dsspfile "1h3eA.bssp"
#ERROR : Can't open dsspfile "3d6vA.bssp"
#ERROR : Can't open dsspfile "3d6uA.bssp"
#ERROR : Can't open dsspfile "1j1uA.bssp"
#ERROR : Can't open dsspfile "2ip1A.bssp"
#ERROR : Can't open dsspfile "2cyaA.bssp"

## Summary of PDB Search
:334
    3e-54  40%  2el7B  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    6e-54  41%  2el7A  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    1e-45  34%  1m83A  [c.26.1] TRYPTOPHAN-TRNA LIGASE
    1e-45  34%  1i6mA  [c.26.1] TRYPTOPHANYL-TRNA SYNTHETASE
    4e-44  34%  1d2rA  [c.26.1] PROTEIN (TRYPTOPHANYL TRNA SYNTHETASE)
    3e-43  33%  2g36A  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    1e-40  34%  1i6kA  [c.26.1] TRYPTOPHANYL-TRNA SYNTHETASE
    1e-40  36%  3fhjF  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    7e-39  36%  3fhjE  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    3e-38  36%  3fhjA  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    4e-38  36%  3fhjD  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    1e-37  36%  3fhjB  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    9e-34  36%  3fhjC  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    2e-33  37%  3fi0I  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    3e-33  37%  2yy5B  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    3e-33  36%  3fi0D  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    2e-32  36%  3fi0G  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    3e-32  38%  2yy5A  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    4e-32  36%  3fi0F  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    5e-32  36%  3fi0A  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    6e-32  35%  3fi0K  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    6e-32  37%  3fi0B  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    8e-32  38%  2yy5C  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    2e-31  35%  3fi0P  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    5e-31  32%  1yi8B  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    3e-30  37%  3fi0R  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    6e-30  36%  3fi0E  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    1e-10  29%  2cybB  [x.x.x] TYROSYL-TRNA SYNTHETASE
    7e-10  29%  2cybA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    3e-06  29%  1zh0A  [x.x.x] TYROSYL-TRNA SYNTHETASE
    4e-06  29%  2ag6A  [x.x.x] TYROSYL-TRNA SYNTHETASE
    6e-06  29%  1zh6A  [x.x.x] TYROSYL-TRNA SYNTHETASE
    5e-05  33%  1h3fB  [c.26.1 - d.66.1] TYROSYL-TRNA SYNTHETASE
    5e-05  33%  1h3fA  [c.26.1 - d.66.1] TYROSYL-TRNA SYNTHETASE
    5e-05  33%  1h3eA  [c.26.1 - d.66.1] TYROSYL-TRNA SYNTHETASE
    8e-05  28%  3d6vA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    8e-05  28%  3d6uA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    1e-04  28%  1j1uA  [c.26.1] TYROSYL-TRNA SYNTHETASE
    4e-04  28%  2ip1A  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    0.001  29%  2cyaA  [x.x.x] TYROSYL-TRNA SYNTHETASE
:334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxQKIILTGVTPSGTPHLGNYIGAIKPAIEMIKNDQYKCMYFIADQHSLIKLWDKKLRQQYIYEIAASWL
2el7B           ---KRVLSGIQPSGEIHIGNYLGAIKQWVEKLGRDAFFC---IVDYHALTNAYDPSTLAQRTFEAALVNI
2el7A           ---KRVLSGIQPSGEIHIGNYLGAIKQWVEKLGRDAFFC---IVDYHALTNAYDPSTLAQRTFEAALVNI
1m83A           ---KTIFSGIQPSGVITIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
1i6mA           ---KTIFSGIQPSGVITIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
1d2rA           ---KTIFSGIQPSGVITIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
2g36A           -----ILSGMRPTGKLHIGHLVGALENWVKL-QEEGNECFYFVADWHALTTHYDDVSKKEYTRDLVRGFL
1i6kA           ---KTIFSGIQPSGVITIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
3fhjF           ---KTIFSGIQPSGVITIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
3fhjE           ------------SGIQTIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
3fhjA           ------------SGIQTIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
3fhjD           ---KTIFSGIQPSGVITIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
3fhjB           ------------SGIQTIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
3fhjC           ------------SGIQTIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
3fi0I           ------------SGIQTIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
2yy5B           ---KRALTGIQASGKQHLGNYLGVMQSLIEL--QEQCQLFVFVADLHSITVDFQPQALKQNNFDLVRTLL
3fi0D           ------------SGIQTIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
3fi0G           -----------------IGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
2yy5A           ---KRALTGIQASGKQHLGNYLGVMQSLIEL--QEQCQLFVFVADLHSITVDFQPQALKQNNFDLVRTLL
3fi0F           ---KTIFSGI------QIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
3fi0A           ------------SGIQTIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
3fi0K           ------------SGIQTIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
3fi0B           ------------SGIQTIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
2yy5C           ---KRALTGIQASGKQHLGNYLGVMQSLIEL--QEQCQLFVFVADLHSITVDFQPQALKQNNFDLVRTLL
3fi0P           ------------SGIQTIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
1yi8B           -----VLTGDRPTXXXXXXXXXXSLQNRVRL--QDEAELFVLLADVQALTDHFDRPEQRENVLAVALDYL
3fi0R           ------------SGIQTIGNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
3fi0E           ------------------GNYIGALRQFVEL--QHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYL
2cybB           --------GYEPSGEIHLGHMMTVQK--LMDLQEAGFEIIVLLADIHAYL---NEKGTFEEIAEVAKVFI
2cybA           --------GYEPSGEIHLGHMMTVQK--LMDLQEAGFEIIVLLADIHAYL---NEKGTFEEIAEVAKVFI
1zh0A           --EKSALIGFEPSGKIHLGHYL-QIKKMID-LQNAGFDIIILLADLHAYL---NQKGELDEIRKIGKVFE
2ag6A           --EKSALIGFEPSGKIHLGHYL-QIKKMID-LQNAGFDIIILLADLHAYL---NQKGELDEIRKIGKVFE
1zh6A           --EKSALIGFEPSGKIHLGHYL-QIKKMID-LQNAGFDIIILLADLHAYL---NQKGELDEIRKIGKVFE
1h3fB           ----------------------------------------------------------------------
1h3fA           ----------------------------------------------------------------------
1h3eA           ----------------------------------------------------------------------
3d6vA           --EKSAIIGFEPSGKIHLGHYL-QIKKMID-LQNAGFDIIILLAD---LFAYLNQKGELDEIRKIGKVFE
3d6uA           --EKSAIIGFEPSGKIHLGHYL-QIKKMID-LQNAGFDIIILLAD---LFAYLNQKGELDEIRKIGKVFE
1j1uA           --EKSAYIGFEPSGKIHLGHYL-QIKKMID-LQNAGFDIIILLADLHAYL---NQKGELDEIRKIGKVFE
2ip1A           ----------------------------------------------------------------------
2cyaA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ALGLDPDKAYFYRQSDIPEIMELTWIISTTTAKGLLNRAHAYKALVDQNLQEENADPDKGITMGLFNYPV
2el7B           AAGLDPEKVTLFVQSHVPEHTELSWVFTTLTPLGDLTRMTQFK---------DKASKQETVWSGLLMYPV
2el7A           AAGLDPEKVTLFVQSHVPEHTELSWVFTTLTPLGDLTRMTQFK---------DKASKQETVWSGLLMYPV
1m83A           AVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFK---------EKSAGKEAVSAGLLTYPP
1i6mA           AVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFK---------EKSAGKEAVSAGLLTYPP
1d2rA           AVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFK---------EKSXXXXXXXXXLLTYPP
2g36A           ACGIDPEKSVIFVQSGVKEHAELALLFSMIVSVSRLERVPTYKE-IDLS------------TAGFLIYPV
1i6kA           AVGIDPTQATLFIQSEVPAHAQAAWL-----------QCIVYIGELERTQFKEKSAGKEAVSAGLLTYPP
3fhjF           AVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERM---------------------VSAGLLTYPP
3fhjE           AVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQVSA-------------------GLLTYPP
3fhjA           AVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQVSA-------------------GLLTYPP
3fhjD           AVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQVSA-------------------GLLTYPP
3fhjB           AVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQVSA-------------------GLLTYPP
3fhjC           AVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQVSA-------------------GLLTYPP
3fi0I           AVGIDPTQATLFIQSEVPAHAQAAWL-QCIVYIGELERTQ--------------------VSAGLLTYPP
2yy5B           AVGLDPQKACLFLQSDLLEHSMMGYLMMVQSNLGELQRMTQFKAKKAE--QTRNPNGTLNIPTGLLTYPA
3fi0D           AVGIDPTQATLFIQSEVPAHAQAAWL-QCIVYIGELERTQ--------------------VSAGLLTYPP
3fi0G           AVGIDPTQATLFIQSEVPAHAQAAWL-QCIVYIGELERTQ--------------------VSAGLLTYPP
2yy5A           AVGLDPQKACLFLQSDLLEHSMMGYLMMVQSNLGELQRMTQFKA-------------KKNIPTGLLTYPA
3fi0F           AVGIDPTQATLFIQSEVPAHAQAAWL-QCIVYIGELERTQ--------------------VSAGLLTYPP
3fi0A           AVGIDPTQATLFIQSEVPAHAQAAWL-QCIVYIGELERTQ--------------------VSAGLLTYPP
3fi0K           AVGIDPTQATLFIQSEVPAHAQAAWLQCIVYIGEL----------------------ERTVSAGLLTYPP
3fi0B           AVGIDPTQATLFIQSEVPAHAQAAWL-QCIVYIGELERTQ--------------------VSAGLLTYPP
2yy5C           AVGLDPQKACLFLQSDLLEHSMMGYLMMVQSNLGELQRMTQFKAKKALN-----------IPTGLLTYPA
3fi0P           AVGIDPTQATLFIQSEVPAHAQAAWLQCIVYIGEL----------------------ERTVSAGLLTYPP
1yi8B           AAGLDPQKTTCVVQSAVPELAELTVYFLNLVTVSHLRQNPTVKAEIAQKGYGER------VPAGFFVYPV
3fi0R           AVGIDPTQATLFIQSEVPAHAQAAWL-QCIVYIGELERTQ--------------------VSAGLLTYPP
3fi0E           AVGIDPTQATLFIQSEVPAHAQAAWL-QCIVYIGELERTQ--------------------VSAGLLTYPP
2cybB           ALGLDESRAKFVLGSEYQLSRDYVLDVLKMARITTLNRAR--RSMDEVSRRKEDPMVSQMI------YPL
2cybA           ALGLDESRAKFVLGSEYQLSRDYVLDVLKMARITTLNRAR--RSMDEVSRRKEDPMVSQMI------YPL
1zh0A           AMGL---KAKYVYGSSFQLDKDYTLNVYRLALKTTLKRARRSMELIAR--EDENPKVAEVI------YPI
2ag6A           AMGL---KAKYVYGSSFQLDKDYTLNVYRLALKTTLKRARRSMELIAR--EDENPKVAEVI------YPI
1zh6A           AMGL---KAKYVYGSEFQLDKDYTLNVYRLALKTTLKRARRSMELIAR--EDENPKVAEVI------YPI
1h3fB           ---------------------------------------------------------EAGIPISLHEYPF
1h3fA           ---------------------------------------------------------EAGIPISLHEYPF
1h3eA           ---------------------------------------------------------EAGIPISLHEYPF
3d6vA           AMGL---KAKYVYGSSFMLDKDYTLNVYRLALKTTLKRARRSMELIAR--EDENPKVAEVI------YPI
3d6uA           AMGL---KAKYVYGSSFMLDKDYTLNVYRLALKTTLKRARRSMELIAR--EDENPKVAEVI------YPI
1j1uA           AMGL---KAKYVYGSEFQLDKDYTLNVYRLALKTTLKRARRSMELIAR--EDENPKVAEVI------YPI
2ip1A           ----------------------------------------------------------------------
2cyaA           -------------------------------------------------------------------YPL


                         +         .         .         .         .         *         .:210
query           LMAADILIFDADLVPVGKDQIQHIEIARDIANRFNHIYQKPVLKAPQALTSEDSQTILGLDGRKMSKSYD
2el7B           LQAADILIYKADTVPVGEDQVQHIELTREIARRFNHLFGE-TFPEPQALLNPEAPRVPGIDGKKMSKSLG
2el7A           LQAADILIYKADTVPVGEDQVQHIELTREIARRFNHLFGE-TFPEPQALLNPEAPRVPGIDGKKMSKSLG
1m83A           LMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGE-LFTIPEARIPKVGARIMSLPTKKMSKSDP
1i6mA           LMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGE-LFTIPEARIPKVGARIMSLPTKKMSKSDP
1d2rA           LMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGE-LFTIPEARIPKVGARIMSLPTKKMSKSDP
2g36A           LQAADILIYKAEGVPVGEDQVYHIELTREIARRFNYLYDE-VFPEPEAILSRVPK-LPGTDGRKMSKSYG
1i6kA           L-AADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGE-LFTIPEARIPKVGARISLVDPTKKSKSDP
3fhjF           LMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRY----------FTIPEARRIMSLPTKKMSKSDP
3fhjE           LMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRY----FTIPEARIPKVGARIMSLPTKKMSKSDP
3fhjA           LMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRY----FTIPEARIPKVGARIMSLPTKKMSKSDP
3fhjD           LMAADILLYNTDIVPVGEDQKQHIELTRDLAERFFTIPEARIPKVGARIMSLVDPT------KKMSKSDP
3fhjB           LMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRY----FTIPERIMSLVDPT------KKMSKSDP
3fhjC           LMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRY----FTIPEARIPKVGARIMSLPTKKMSKSDP
3fi0I           L-AADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGE-LFTIPEARIPKVGARISLVDPTKKSKSDP
2yy5B           LMAGDILLYQPDIVPVGNDQKQHLELTRDLAQRIQKKF-KLKLRLPQFVQNKDTNRIMDLPTKKMSKSSK
3fi0D           L-AADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGE-LFTIPEARIPKVGARISLVDPTKKSKSDP
3fi0G           L-AADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGE-LFTIPEARIPKVGARISLVDPTKKSKSDP
2yy5A           LMAGDILLYQPDIVPVGNDQKQHLELTRDLAQRIQKKF-KLKLRLPQFVQNKDTNRIMDLPTKKMSKSSK
3fi0F           L-AADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRFTIPEARIPKV-----GARISLVDPTKKSKSDP
3fi0A           L-AADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGE-LFTIPEARIPRISL----VDPTKKSKSDP
3fi0K           L-AADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGE-LFTIPEARIPKVGARISLVDPTKKSKSDP
3fi0B           L-AADILLYNTDIVPVGEDQKQHIELTRDLAERFNYLFTIPEARIPR---------ISLVDPTKKSKSDP
2yy5C           LMAGDILLYQPDIVPVGNDQKQHLELTRDLAQRIQKKF-KLKLRLPQFVQNKDTNRIMDLPTKKMSKSSK
3fi0P           L-AADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGE-LFTIPEARIPKVGARISLVDPTKKSKSDP
1yi8B           SQAADIAAFGATLVPVGDDQLPMLEQTREIVRRFNALY-APVLAEPQAQLSRVPR-LPGLDGQKMSKSLG
3fi0R           L-AADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGE-LFTIPEARIPRISL----VDPTKKSKSDP
3fi0E           L-AADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGE-LFTIPEARIPKVGARISLVDPTKKSKSDP
2cybB           MQALDIAHLGVDLAVGGIDQRKIHMLARENLPRLG--YSSPVLHTP---------ILVGLDGQKMSSSKG
2cybA           MQALDIAHLGVDLAVGGIDQRKIHMLARENLPRLG--YSSPVLHTP---------ILVGLDGQKMSSSKG
1zh0A           MQVNPAHYQGVDVVVGGMEQRKIHMLAREL--------------LPKKVVCIHNPVLTGLDGEKMSSSKG
2ag6A           MQVNPLHYEGVDVAVGGMEQRKIHMLAREL--------------LPKKVVCIHNPVLTGLDGEKMSSSKG
1zh6A           MQVNGCHYRGVDVAVGGMEQRKIHMLAREL--------------LPKKVVCIHNPVLTGLDGEKMSSSKG
1h3fB           AQAYDSVAIRADVEMGGTDQRFNLLVGREVQRAYGQSPQVCFLMP----------LLVGLDGRKMSKSLD
1h3fA           AQAYDSVAIRADVEMGGTDQRFNLLVGREVQRAYGQSPQVCFLMP----------LLVGLDGRKMSKSLD
1h3eA           AQAYDSVAIRADVEMGGTDQRFNLLVGREVQRAYGQSPQVCFLMP----------LLVGLDGRKMSKSLD
3d6vA           MQVNPLHYEGVDVAVGGMEQRKIHMLAREL--------------LPKKVVCIHNPVLTGLDGEKMSSSKG
3d6uA           MQVNPLHYEGVDVAVGGMEQRKIHMLAREL--------------LPKKVVCIHNPVLTGLDGEKMSSSKG
1j1uA           MQVNDIHYLGVDVAVGGMEQRKIHMLAREL--------------LPKKVVCIHNPVLTGLDGE------G
2ip1A           ------------LIPCAIDQDPYFRVCRDVADKLK--YSKPALL--------HSRFFPALQG-------D
2cyaA           MQVSDIFYMDLDIALGGMDQRKAHMLARDVAEKLGR--KKPVAIHTPIISSLQGPV-------KMSKSKP


                         .         .         .         +         .         .         .:280
query           NTIAIFSMEKKLRKQVMKIITNSQMPEEKKDPNNCTIFAIYKSIASQTEIAALEEKYLAGGLGWGDAKQI
2el7B           NTIGLLEPEESIWQKIQHL------------PDDTILFTYLSYFAPKDLVEALKEEYRKAGVGTYVVKRI
2el7A           NTIGLLEPEESIWQKIQHL------------PDDPTILFTYLSFAPKDLVEALKEEYRKAGVGTYVVKRI
1m83A           NPITLLDDAKTIEKKIKSAVTDSERYDKEAKPGISNLLNIYSTLSGQS-IEELERQY--EGKGYGVFKAD
1i6mA           NPITLLDDAKTIEKKIKSAVTDSERYDKEAKPGISNLLNIYSTLSGQS-IEELERQY--EGKGYGVFKAD
1d2rA           NPITLLDDAKTIEKKIKSAVTDSERYDKEAKPGISNLLNIYSTLSGQS-IEELERQY--EGKGYGVFKAD
2g36A           NIINLEISEKELEQTILRMMTDPARRSDPGNPENCPVWKYHQAFISEEESKWVWEGCTTASIGCVDCXXX
1i6kA           NPITLLDDAKTIEKKIKSAVTDSERYDKEAKPGISNLLNIYSTLSGQS-IEELERQY--EGKGYGVFKAD
3fhjF           NPKAYITLLDD-AKTIEKKIKSSE--GTIRYPGISNLLNIYSTLSGQS-IEELERQY--EGKGYGVFKAD
3fhjE           NP-----------KAYITLLDDAKTIEKKKSPGISNLLNIYSTLSGQS-IEELERQY--EGKGYGVFKAD
3fhjA           NPKAYITLLDD-AKTIEKKIKSSE--GTIRYPGISNLLNIYSTLSGQS-IEELERQY--EGKGYGVFKAD
3fhjD           NPITLLDDAKTIEKKIKSAISN--------------LLNIYSTLSGQS-IEELERQYV--------FKAD
3fhjB           NPKAYITLLDD-AKTIEKKIKSSE--GTIRYPGISNLLNIYSTLSGQS-IEELERQY--EGKGYGVFKAD
3fhjC           NP-----------KAYITLLDDAKTIEKK-----------IKSSEGTPGISNLLNIYSTLGVFKADLAQV
3fi0I           NPKAYITLEKKIKSSEGTGISN--------------LLNIYSTLSGQS-IEELERQY--EGKGYGVFKAD
2yy5B           NQNGVIYLDDPKEVVVKKI---------------------------------------------------
3fi0D           NPKAYITLLDD-AKTIEKKIKSSEGTIRYGISN---LLNIYSTLSGQS-IEELERQY--EGKGYGVFKAD
3fi0G           NPKAYITLLDD-AKTIEKKIKSSEGTIRYGISN---LLNIYSTLSGQS-IEELERQY--EGKGYGVFKAD
2yy5A           NQNGVIYLDDPKEVVVKKI---------------------------------------------------
3fi0F           NPKAYITLLDD-AKTIEKKIKSSEGTIRYGISN---LLNIYSTLSGQS-IEELERQY--EGKGYGVFKAD
3fi0A           NPKAYITLLDD-AKTIEKKIKSSEGTIRYGISN---LLNIYSTLSGQS-IEELERQY--EGKGYGVFKAD
3fi0K           NPKAYITLLDD-AKTIEKKIKSSEGTIRYGISN---LLNIYSTLSGE-----LERQY--EGKGYGVFKAD
3fi0B           NPKAYITLLDD-AKTIEKKIKSSEGTIRYGISN---LLNIYSTLSGQS-IEELERQY--EGKGYGVFKAD
2yy5C           NQNGVIYLDDPKEVVVKKI---------------------------------------------------
3fi0P           NPKAYITLLDD-AKTIEKKIKSSEGTIRYGISN---LLNIYSTLSGQS-IEELERQY-------GVFKAD
1yi8B           NAIALGDSADEVARKVMGMYTDPRASDPGRVEGNPVFTFLDAFDPDPARVQALKDQYRAGGLGDVKVKKH
3fi0R           NP-----------KAYITLLDDAKTIEKKIKSSEGTILNIYSTLSGQS-IEELERQY-------GVFKAD
3fi0E           NPKAYITLLDD-AKTIEKKIKSSEGTIRYDGISN--LLNIYSTLSGQ----SIEE--LERGVFKADLAQV
2cybB           NYISVRDPPEEVERKIRKAYCPAGVVEENPDIAKYHILPRFGKIAGDVEYASFEEDFKSGQLHPLDLKIA
2cybA           NYISVRDPPEEVERKIRKAYCPAGVVEENPDIAKYHILPRFGKIGGDVEYASFEEDFKSGQLHPLDLKIA
1zh0A           NFIAVDDSPEEIRAKIKK----------------------------------------------------
2ag6A           NFIAVDDSPEEIRAKIKK----------------------------------------------------
1zh6A           NFIAVDDSPEEIRAKIKK----------------------------------------------------
1h3fB           NYIGLTEPPEAMFKKLMRV---------------------------------------------------
1h3fA           NYIGLTEPPEAMFKKLMRV---------------------------------------------------
1h3eA           NYIGLTEPPEAMFKKLMRV---------------------------------------------------
3d6vA           NFIAVDDSPEEIRAKIKK----------------------------------------------------
3d6uA           NFIAVDDSPEEIRAKIKK----------------------------------------------------
1j1uA           NFIAVDDSPEEIRAKIKK----------------------------------------------------
2ip1A           DTTAIFMTDKQIQKKINKYAVSADLHRELGGNPDVDVAYQYLSFFKDDDVFLKEDKYKSGELLSGEMKKL
2cyaA           ET-AVFVVDS--XXXXXXXXXXAYCPAKQVQGNPVLEIARYILFAEYTSYEELERDYTDGRLHPLDLKNA


                         .         *         .         .         .         .         +:350
query           LFEKINEYLRDAREKYDYYINNPKIVDDILNQGAAKVRPLAKDKLKEVKDIIGM
2el7B           LFDHLMEALRPIRERAEALKKDPDYVMDALLEGAKRARAVAQATMEEVREKVGL
2el7A           LFDHLMEALRPIRERAEALKKDPDYVMDALLEGAKRARAVAQATMEEVREKVGL
1m83A           LAQVVIETLRPIQERYHHWMESEEL-DRVLDEGAEKANRVASEMVRKMEQAMGL
1i6mA           LAQVVIETLRPIQERYHHWMESEEL-DRVLDEGAEKANRVASEMVRKMEQAMGL
1d2rA           LAQVVIETLRPIQERYHHWMESEEL-DRVLDEGAEKANRVASEMVRKMEQAMGL
2g36A           XXXXXXXXXAPIWENFRKIDEDPHYVDDVIMEGTKKAREVAAKTMEEVR-----
1i6kA           LAQVVIETLRPIQERYHHW--ESEELDRVLDEGAEKANRVASEVRKE-------
3fhjF           LAQVVIETLRPIQERYHHWMESEEL-DRVLDEGAEKANRVASEMVRKMEQAMGL
3fhjE           LAQVVIETLRPIQERYHHWMESEEL-DRVLDEGAEKANRVASEMVRKMEQAMGL
3fhjA           LAQVVIETLRPIQERYHHWMESEEL-DRVLDEGAEKANRVASEMVRKMEQAMGL
3fhjD           LAQVVIETLRPIQERYHHWMESEEL-DRVLDEGAEKANRVASEMVRKMEQAMGL
3fhjB           LAQVVIETLRPIQERYHHWMESEEL-DRVLDEGAEKANRVASEMVRKMEQAMGL
3fhjC           VIET----LRPIQERYHHWMESEEL-DRVLDEGAEKANRVASEMVRKMEQAMGL
3fi0I           LAQVVIETLRPIQERYHHW--ESEELDRVLDEGAEKANRVASEVRKE-------
2yy5B           ------------------------------------------------------
3fi0D           LAQVVIETLRPIQERYHHW--ESEELDRVLDEGAEKANRVASEVRKE-------
3fi0G           LAQVVIETLRPIQERYHHW--ESEELDRVLDEGAEKANRVASEVRKE-------
2yy5A           ------------------------------------------------------
3fi0F           LAQVVIETLRPIQERYHHW--ESEELDRVLDEGAEKANRVASEVRKE-------
3fi0A           LAQVVIETLRPIQERYHHW--ESEELDRVLDEGAEKANRVASEVRKE-------
3fi0K           LAQVVIETLRPIQERYHHW--ESEELDRVLDEGAEKANRVASEVRKE-------
3fi0B           LAQVVIETLRPIQERYHHW--ESEELDRVLDEGAEKANRVASEVRKE-------
2yy5C           ------------------------------------------------------
3fi0P           LAQVVIETLRPIQERYHHW--ESEELDRVLDEGAEKANRVASEVRKE-------
1yi8B           LIDVLNGVLAPIRTRRAEYERDPDAVLRFVTEGTARGREVAAQTLGQVR-----
3fi0R           LAQVVIETLRPIQERYHHW--ESEELDRVLDEGAEKANRVASEVRKE-------
3fi0E           VIET----LRPIQERYHHW--ESEELDRVLDEGAEKANRVASEVRKE-------
2cybB           VAKYLNMLLEDARKR---------------------------------------
2cybA           VAKYLNMLLEDARKR---------------------------------------
1zh0A           ------------------------------------------------------
2ag6A           ------------------------------------------------------
1zh6A           ------------------------------------------------------
1h3fB           ------------------------------------------------------
1h3fA           ------------------------------------------------------
1h3eA           ------------------------------------------------------
3d6vA           ------------------------------------------------------
3d6uA           ------------------------------------------------------
1j1uA           ------------------------------------------------------
2ip1A           CIETLQEFVKAFQER---------------------------------------
2cyaA           VAESLIEVVRPIR-----------------------------------------