[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:ACD30480.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3f6vA.bssp"
#ERROR : Can't open dsspfile "1u2wC.bssp"
#ERROR : Can't open dsspfile "1u2wB.bssp"
#ERROR : Can't open dsspfile "3f72B.bssp"
#ERROR : Can't open dsspfile "1r1vB.bssp"
#ERROR : Can't open dsspfile "1r1uD.bssp"
#ERROR : Can't open dsspfile "1r1uC.bssp"
#ERROR : Can't open dsspfile "1r1uB.bssp"
#ERROR : Can't open dsspfile "1r1uA.bssp"
#ERROR : Can't open dsspfile "3f72F.bssp"
#ERROR : Can't open dsspfile "3f72C.bssp"
#ERROR : Can't open dsspfile "3f72A.bssp"
#ERROR : Can't open dsspfile "1u2wA.bssp"
#ERROR : Can't open dsspfile "3f72D.bssp"
#ERROR : Can't open dsspfile "3f72E.bssp"
#ERROR : Can't open dsspfile "3f6oB.bssp"
#ERROR : Can't open dsspfile "3f6oA.bssp"
#ERROR : Can't open dsspfile "1u2wD.bssp"

## Summary of PDB Search
:121
    2e-08  30%  3f6vA  [x.x.x] POSSIBLE TRANSCRIPTIONAL REGULATOR, ARSR FAMILY
    2e-07  27%  1u2wC  [x.x.x] CADMIUM EFFLUX SYSTEM ACCESSORY PROTEIN
    2e-07  27%  1u2wB  [x.x.x] CADMIUM EFFLUX SYSTEM ACCESSORY PROTEIN
    7e-07  31%  3f72B  [x.x.x] CADMIUM EFFLUX SYSTEM ACCESSORY PROTEIN
    3e-06  30%  1r1vB  [a.4.5] REPRESSOR PROTEIN
    3e-06  30%  1r1uD  [a.4.5] REPRESSOR PROTEIN
    3e-06  30%  1r1uC  [a.4.5] REPRESSOR PROTEIN
    3e-06  30%  1r1uB  [a.4.5] REPRESSOR PROTEIN
    3e-06  30%  1r1uA  [a.4.5] REPRESSOR PROTEIN
    1e-05  31%  3f72F  [x.x.x] CADMIUM EFFLUX SYSTEM ACCESSORY PROTEIN
    1e-05  31%  3f72C  [x.x.x] CADMIUM EFFLUX SYSTEM ACCESSORY PROTEIN
    1e-05  31%  3f72A  [x.x.x] CADMIUM EFFLUX SYSTEM ACCESSORY PROTEIN
    4e-05  30%  1u2wA  [x.x.x] CADMIUM EFFLUX SYSTEM ACCESSORY PROTEIN
    4e-05  30%  3f72D  [x.x.x] CADMIUM EFFLUX SYSTEM ACCESSORY PROTEIN
    7e-05  29%  3f72E  [x.x.x] CADMIUM EFFLUX SYSTEM ACCESSORY PROTEIN
    3e-04  34%  3f6oB  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, ARSR FAMILY
    3e-04  34%  3f6oA  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, ARSR FAMILY
    7e-04  31%  1u2wD  [x.x.x] CADMIUM EFFLUX SYSTEM ACCESSORY PROTEIN
:121

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxLANIVDFQKALGDETRIRILMVIYQHQLCLCHLAHIFKLANSTLSKHLDILRRNGFIHKRKQGRFHYF
3f6vA           -----VLDQLEVAAEPTRRRLVQLLTSGEQTVNNLAAHFPASRSAISQHLRVLTEAGLVTPRKDGRFRYY
1u2wC           --ISGVSQILKAIADENRAKITYALCQEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRKEGKLALY
1u2wB           --ISGVSQILKAIADENRAKITYALCQEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRKEGKLALY
3f72B           --ISGVSQILKAIADENRAKITYALCQEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRKEGK----
1r1vB           --LERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQ----
1r1uD           --LERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQ----
1r1uC           --LERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQ----
1r1uB           --LERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQ----
1r1uA           --LERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQ----
3f72F           --ISGVSQILKAIADENRAKITYALCQEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRK-------
3f72C           --ISGVSQILKAIADENRAKITYALCQEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRK-------
3f72A           --ISGVSQILKAIADENRAKITYALCQEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRK-------
1u2wA           --ISGVSQILKAIADENRAKITYALCQEELCVCDIANILGVTIANASHHLRTLYKQGVVNFR--------
3f72D           --ISGVSQILKAIADENRAKITYALCQEELCVCDIANILGVTIANASHHLRTLYKQGVVNFR--------
3f72E           --ISGVSQILKAIADENRAKITYALCQEELCVCDIANILGVTIANASHHLRTLYKQGVVN----------
3f6oB           ----------QALADPTRRAVLGRLSRGPATVSELAKPFDMALPSFMKHIHFLEDSGWIRTHKQGR----
3f6oA           ----------QALADPTRRAVLGRLSRGPATVSELAKPFDMALPSFMKHIHFLEDSGWIRTHKQGR----
1u2wD           --ISGVSQILKAIADENRAKITYALCQEELCVCDIANILGVTIANASHHLRTL-----------------


                         .         .         *         .         .         .         .:140
query           YFNSAYQQQLNWLFDILADDEIxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3f6vA           RLDPQGLAQLRALFDSFWIDEL-----------------------------
1u2wC           SLGDEHIRQI-----------------------------------------
1u2wB           SLGDEHIRQI-----------------------------------------
3f72B           ---------------------------------------------------
1r1vB           ---------------------------------------------------
1r1uD           ---------------------------------------------------
1r1uC           ---------------------------------------------------
1r1uB           ---------------------------------------------------
1r1uA           ---------------------------------------------------
3f72F           ---------------------------------------------------
3f72C           ---------------------------------------------------
3f72A           ---------------------------------------------------
1u2wA           ---------------------------------------------------
3f72D           ---------------------------------------------------
3f72E           ---------------------------------------------------
3f6oB           ---------------------------------------------------
3f6oA           ---------------------------------------------------
1u2wD           ---------------------------------------------------