[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:ACD30541.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2vl0A.bssp"
#ERROR : Can't open dsspfile "3ei0A.bssp"
#ERROR : Can't open dsspfile "3ehzA.bssp"
#ERROR : Can't open dsspfile "3eamA.bssp"
#ERROR : Can't open dsspfile "2bg9E.bssp"
#ERROR : Can't open dsspfile "2bg9B.bssp"
#ERROR : Can't open dsspfile "2zjvC.bssp"
#ERROR : Can't open dsspfile "2zjvB.bssp"
#ERROR : Can't open dsspfile "2zjuC.bssp"
#ERROR : Can't open dsspfile "2zjuB.bssp"
#ERROR : Can't open dsspfile "2zjuA.bssp"
#ERROR : Can't open dsspfile "2bg9C.bssp"
#ERROR : Can't open dsspfile "1yi5E.bssp"
#ERROR : Can't open dsspfile "1yi5C.bssp"
#ERROR : Can't open dsspfile "1yi5B.bssp"
#ERROR : Can't open dsspfile "1yi5A.bssp"
#ERROR : Can't open dsspfile "1ux2A.bssp"
#ERROR : Can't open dsspfile "1uw6B.bssp"
#ERROR : Can't open dsspfile "1uw6A.bssp"
#ERROR : Can't open dsspfile "1uv6A.bssp"
#ERROR : Can't open dsspfile "1i9bA.bssp"

## Summary of PDB Search
:351
    3e-19  26%  2vl0A  [x.x.x] ELIC PENTAMERIC LIGAND GATED ION CHANNEL FROM
    8e-19  22%  3ei0A  [x.x.x] GLR4197 PROTEIN
    2e-18  21%  3ehzA  [x.x.x] GLR4197 PROTEIN
    2e-18  21%  3eamA  [x.x.x] GLR4197 PROTEIN
    3e-08  23%  2bg9E  [x.x.x] ACETYLCHOLINE RECEPTOR PROTEIN, GAMMA CHAIN
    9e-07  28%  2bg9B  [x.x.x] ACETYLCHOLINE RECEPTOR PROTEIN, BETA CHAIN
    1e-04  25%  2zjvC  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    1e-04  25%  2zjvB  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    1e-04  25%  2zjuC  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    1e-04  25%  2zjuB  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    1e-04  25%  2zjuA  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    4e-04  25%  2bg9C  [x.x.x] ACETYLCHOLINE RECEPTOR PROTEIN, DELTA CHAIN
    6e-04  24%  1yi5E  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    6e-04  24%  1yi5C  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    6e-04  24%  1yi5B  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    6e-04  24%  1yi5A  [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
    6e-04  24%  1ux2A  [b.96.1] ACETYLCHOLINE BINDING PROTEIN
    6e-04  24%  1uw6B  [b.96.1] ACETYLCHOLINE-BINDING PROTEIN
    6e-04  24%  1uw6A  [b.96.1] ACETYLCHOLINE-BINDING PROTEIN
    6e-04  24%  1uv6A  [b.96.1] ACETYLCHOLINE-BINDING PROTEIN
    6e-04  24%  1i9bA  [b.96.1] ACETYLCHOLINE BINDING PROTEIN
:351

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxIPPQKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLE
2vl0A           -------------------------------PVDVSVSIFINKIYGVNTLEQTYKVDGYIVAQWTGK---
3ei0A           ---------------------------PPDEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLA
3ehzA           ---------------------------PPDEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLA
3eamA           ---------------------------PPDEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLA
2bg9E           ----------------------------------------LTNLISLNEKEEALTTNVWIEIQWNDYRLS
2bg9B           ----------------------------------VRVGLTLTSLLILNEKNEEMTTSVFLNLAWTDYRLQ
2zjvC           --------------------------IPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFQTTWSDRTLA
2zjvB           --------------------------IPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFQTTWSDRTLA
2zjuC           --------------------------IPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFQTTWSDRTLA
2zjuB           --------------------------IPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFQTTWSDRTLA
2zjuA           --------------------------IPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFQTTWSDRTLA
2bg9C           ----------------------------------IALSLTLSNLISLKETDETLTTNVWMDHAWYDHRLT
1yi5E           --------------------------IPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFQTTWSDRTLA
1yi5C           --------------------------IPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFQTTWSDRTLA
1yi5B           --------------------------IPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFQTTWSDRTLA
1yi5A           --------------------------IPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFQTTWSDRTLA
1ux2A           --------------------------IPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFQTTWSDRTLA
1uw6B           --------------------------IPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFQTTWSDRTLA
1uw6A           --------------------------IPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFQTTWSDRTLA
1uv6A           --------------------------IPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFQTTWSDRTLA
1i9bA           --------------------------IPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFQTTWSDRTLA


                         .         .         *         .         .         .         .:140
query           FDKNEEKTPYKLYQGDFQYDEVFEGWKPQISIINEIGTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRL
2vl0A           ----PRKTPKPLIVENTQIERWINNWVPALEFINVVGSPDTGNKRLMLFPDGRVIYNARFLGSFSNDMDF
3ei0A           FDPVRSGVRVKTYEPEAI-------WIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDF
3ehzA           FDPVRSGVRVKTYEPEAI-------WIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDF
3eamA           FDPVRSGVRVKTYEPEAI-------WIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDF
2bg9E           WNTSE-------YEGDLVRIPSELLWLPDVVLENNVGQFEVAYANVLVYNDGSMYWLPPAIYRSTCPIAV
2bg9B           WDP-------AAYEGSIPSDDV---WQPDIVLMNNDGSFEITLHNVLVQHTGAVSWHPSAIYRSSCTIKV
2zjvC           WDSSHSPDQVSV--------PISSLWVPDLAAYNAISKPEVLTPQLRVVSDGEVLY--------------
2zjvB           WDSSHSPDQVSV--------PISSLWVPDLAAYNAISKPEVLTPQLRVVSDGEVLY--------------
2zjuC           WDSSHSPDQVSV--------PISSLWVPDLAAYNAISKPEVLTPQLRVVSDGEVLY--------------
2zjuB           WDSSHSPDQVSV--------PISSLWVPDLAAYNAISKPEVLTPQLRVVSDGEVLY--------------
2zjuA           WDSSHSPDQVSV--------PISSLWVPDLAAYNAISKPEVLTPQLRVVSDGEVLY--------------
2bg9C           WNASEYSDISILRLRP----ELI--WIPDIVLQNNNDGQYNVAYNVLVRPNGYVTWLPPAIFRSSCPINV
1yi5E           WNSSHSPDQVSV--------PISSLWVPDLAAYNAISKPEVLTPQLRVVSDGEVLY--------------
1yi5C           WNSSHSPDQVSV--------PISSLWVPDLAAYNAISKPEVLTPQLRVVSDGEVLY--------------
1yi5B           WNSSHSPDQVSV--------PISSLWVPDLAAYNAISKPEVLTPQLRVVSDGEVLY--------------
1yi5A           WNSSHSPDQVSV--------PISSLWVPDLAAYNAISKPEVLTPQLRVVSDGEVLY--------------
1ux2A           WNSSHSPDQVSV--------PISSLWVPDLAAYNAISKPEVLTPQLRVVSDGEVLY--------------
1uw6B           WNSSHSPDQVSV--------PISSLWVPDLAAYNAISKPEVLTPQLRVVSDGEVLY--------------
1uw6A           WNSSHSPDQVSV--------PISSLWVPDLAAYNAISKPEVLTPQLRVVSDGEVLY--------------
1uv6A           WNSSHSPDQVSV--------PISSLWVPDLAAYNAISKPEVLTPQLRVVSDGEVLY--------------
1i9bA           WNSSHSPDQVSV--------PISSLWVPDLAAYNAISKPEVLTPQLRVVSDGEVLY--------------


                         +         .         .         .         .         *         .:210
query           EKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGK
2vl0A           RLFPFDRQQFVLELEPFSYNNQQLRF-------SDIQVYTENIDNEEIDEWWIRKAS-THISDIRYDHLS
3ei0A           RRYPFDSQTLHIYLIVRSVDTRNIVLAVD-------LEKVGKNDDVFLTGWDIESFTAV-VKPANFAL-E
3ehzA           RRYPFDSQTLHIYLIVRSVDTRNIVLAVD-------LEKVGKNDDVFLTGWDIESFTAV-VKPANFAL-E
3eamA           RRYPFDSQTLHIYLIVRSVDTRNIVLAVD-------LEKVGKNDDVFLTGWDIESFTAV-VKPANFAL-E
2bg9E           TYFPFDWQNCSLVFRSQTYNAHEVNLQLSAEEGIDPEDFIRHRPAKKNYNWQLTKDDIDFQEII------
2bg9B           MYFPFDWQNCTMVFKSYTYDTSEVIL--------------------------------------------
2zjvC           ----------------------------------------------------------------------
2zjvB           ----------------------------------------------------------------------
2zjuC           ----------------------------------------------------------------------
2zjuB           ----------------------------------------------------------------------
2zjuA           ----------------------------------------------------------------------
2bg9C           LYFPFDWQNCSLKFTALNYNANEIDLIIDP----------------------------------------
1yi5E           ----------------------------------------------------------------------
1yi5C           ----------------------------------------------------------------------
1yi5B           ----------------------------------------------------------------------
1yi5A           ----------------------------------------------------------------------
1ux2A           ----------------------------------------------------------------------
1uw6B           ----------------------------------------------------------------------
1uw6A           ----------------------------------------------------------------------
1uv6A           ----------------------------------------------------------------------
1i9bA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PQRISMLEFSISLERKPTNXXXXXXXXXXXXXXAMWAIFWMDTKALSDRLNIAFIGILSVIAYQFLIEGE
2vl0A           SVQPNQNEFSIDAVRNPSYYLWSFILPLGLIIAASWSVFWLE--SFSERLQTSFTLMLTVVAYAFYTSNI
3ei0A           DRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYAANVTLVVS--TLIAHIAFNILVETN
3ehzA           DRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFW--STSYEANVTLVVSTLIAHIAFNILVETN
3eamA           DRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFW--STSYEANVTLVVSTLIAHIAFNILVETN
2bg9E           --------FFLIIQRKPLFYIINIIAPCVLISSLVVLVYFLPAQAGGQKCTLSISVLLAQTIFLFLIAQK
2bg9B           ----------------------------------------------------------------------
2zjvC           ----------------------------------------------------------------------
2zjvB           ----------------------------------------------------------------------
2zjuC           ----------------------------------------------------------------------
2zjuB           ----------------------------------------------------------------------
2zjuA           ----------------------------------------------------------------------
2bg9C           ----------------------------------------------------------------------
1yi5E           ----------------------------------------------------------------------
1yi5C           ----------------------------------------------------------------------
1yi5B           ----------------------------------------------------------------------
1yi5A           ----------------------------------------------------------------------
1ux2A           ----------------------------------------------------------------------
1uw6B           ----------------------------------------------------------------------
1uw6A           ----------------------------------------------------------------------
1uv6A           ----------------------------------------------------------------------
1i9bA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           MPDIDYLTFTDGXXXXXXXXXXXTVLESLAVYWLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2vl0A           LPRLPYTTVID-----------------------------------------------------------
3ei0A           LPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYL------------------------------------
3ehzA           LPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYL------------------------------------
3eamA           LPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYL------------------------------------
2bg9E           VPE-------------------------------------------------------------------
2bg9B           ----------------------------------------------------------------------
2zjvC           ----------------------------------------------------------------------
2zjvB           ----------------------------------------------------------------------
2zjuC           ----------------------------------------------------------------------
2zjuB           ----------------------------------------------------------------------
2zjuA           ----------------------------------------------------------------------
2bg9C           ----------------------------------------------------------------------
1yi5E           ----------------------------------------------------------------------
1yi5C           ----------------------------------------------------------------------
1yi5B           ----------------------------------------------------------------------
1yi5A           ----------------------------------------------------------------------
1ux2A           ----------------------------------------------------------------------
1uw6B           ----------------------------------------------------------------------
1uw6A           ----------------------------------------------------------------------
1uv6A           ----------------------------------------------------------------------
1i9bA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           x
2vl0A           -
3ei0A           -
3ehzA           -
3eamA           -
2bg9E           -
2bg9B           -
2zjvC           -
2zjvB           -
2zjuC           -
2zjuB           -
2zjuA           -
2bg9C           -
1yi5E           -
1yi5C           -
1yi5B           -
1yi5A           -
1ux2A           -
1uw6B           -
1uw6A           -
1uv6A           -
1i9bA           -