[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:glgB

[Show Plain Result]

#ERROR : Can't open dsspfile "1m7xB.bssp"
#ERROR : Can't open dsspfile "1m7xA.bssp"
#ERROR : Can't open dsspfile "1m7xD.bssp"
#ERROR : Can't open dsspfile "1m7xC.bssp"
#ERROR : Can't open dsspfile "1ehaA.bssp"
#ERROR : Can't open dsspfile "1eh9A.bssp"
#ERROR : Can't open dsspfile "2e8yA.bssp"
#ERROR : Can't open dsspfile "2bhuA.bssp"
#ERROR : Can't open dsspfile "2vuyB.bssp"
#ERROR : Can't open dsspfile "2vuyA.bssp"
#ERROR : Can't open dsspfile "2vr5B.bssp"
#ERROR : Can't open dsspfile "2vr5A.bssp"
#ERROR : Can't open dsspfile "2vncB.bssp"
#ERROR : Can't open dsspfile "2vncA.bssp"
#ERROR : Can't open dsspfile "2wanA.bssp"
#ERROR : Can't open dsspfile "3fawA.bssp"
#ERROR : Can't open dsspfile "2bhzA.bssp"
#ERROR : Can't open dsspfile "2bhyA.bssp"
#ERROR : Can't open dsspfile "1j0jA.bssp"
#ERROR : Can't open dsspfile "1j0hA.bssp"
#ERROR : Can't open dsspfile "3faxA.bssp"
#ERROR : Can't open dsspfile "1smaA.bssp"
#ERROR : Can't open dsspfile "1gviA.bssp"
#ERROR : Can't open dsspfile "1wzaA.bssp"
#ERROR : Can't open dsspfile "2aaaA.bssp"
#ERROR : Can't open dsspfile "1bf2A.bssp"
#ERROR : Can't open dsspfile "2taaA.bssp"
#ERROR : Can't open dsspfile "1wzlA.bssp"
#ERROR : Can't open dsspfile "2ze0A.bssp"
#ERROR : Can't open dsspfile "2wkgA.bssp"
#ERROR : Can't open dsspfile "2wcsA.bssp"
#ERROR : Can't open dsspfile "2wc7A.bssp"
#ERROR : Can't open dsspfile "1d7fA.bssp"
#ERROR : Can't open dsspfile "1jf5A.bssp"
#ERROR : Can't open dsspfile "1jf6A.bssp"
#ERROR : Can't open dsspfile "1wzmA.bssp"
#ERROR : Can't open dsspfile "1v3kA.bssp"
#ERROR : Can't open dsspfile "1v3jA.bssp"
#ERROR : Can't open dsspfile "1pamA.bssp"
#ERROR : Can't open dsspfile "1bvzA.bssp"
#ERROR : Can't open dsspfile "1wzkA.bssp"
#ERROR : Can't open dsspfile "1ea9C.bssp"
#ERROR : Can't open dsspfile "2guyA.bssp"
#ERROR : Can't open dsspfile "1qhoA.bssp"
#ERROR : Can't open dsspfile "1vfmA.bssp"
#ERROR : Can't open dsspfile "1g1yA.bssp"
#ERROR : Can't open dsspfile "1vb9A.bssp"
#ERROR : Can't open dsspfile "1h3gA.bssp"
#ERROR : Can't open dsspfile "3edfA.bssp"
#ERROR : Can't open dsspfile "3edeA.bssp"
#ERROR : Can't open dsspfile "3eddA.bssp"
#ERROR : Can't open dsspfile "1uksA.bssp"
#ERROR : Can't open dsspfile "1uktA.bssp"
#ERROR : Can't open dsspfile "1g5aA.bssp"
#ERROR : Can't open dsspfile "3dhuB.bssp"
#ERROR : Can't open dsspfile "1rp8A.bssp"
#ERROR : Can't open dsspfile "2qpuA.bssp"
#ERROR : Can't open dsspfile "2qpsA.bssp"
#ERROR : Can't open dsspfile "1mvyA.bssp"
#ERROR : Can't open dsspfile "1jgiA.bssp"
#ERROR : Can't open dsspfile "1ht6A.bssp"
#ERROR : Can't open dsspfile "3bsgA.bssp"
#ERROR : Can't open dsspfile "3bshA.bssp"
#ERROR : Can't open dsspfile "1cgyA.bssp"
#ERROR : Can't open dsspfile "1tcmA.bssp"
#ERROR : Can't open dsspfile "1pj9A.bssp"
#ERROR : Can't open dsspfile "1kckA.bssp"
#ERROR : Can't open dsspfile "1cxlA.bssp"
#ERROR : Can't open dsspfile "1cgwA.bssp"
#ERROR : Can't open dsspfile "1cgvA.bssp"
#ERROR : Can't open dsspfile "1cdgA.bssp"
#ERROR : Can't open dsspfile "1dtuA.bssp"
#ERROR : Can't open dsspfile "1cygA.bssp"
#ERROR : Can't open dsspfile "1cgxA.bssp"
#ERROR : Can't open dsspfile "3bmvA.bssp"
#ERROR : Can't open dsspfile "1a47A.bssp"
#ERROR : Can't open dsspfile "1uokA.bssp"
#ERROR : Can't open dsspfile "1pezA.bssp"
#ERROR : Can't open dsspfile "1lwhA.bssp"
#ERROR : Can't open dsspfile "1kclA.bssp"
#ERROR : Can't open dsspfile "1d3cA.bssp"
#ERROR : Can't open dsspfile "1eo5A.bssp"
#ERROR : Can't open dsspfile "4cgtA.bssp"

## Summary of PDB Search
:640
    e-152  45%  1m7xB  [b.1.18 - c.1.8 - b.71.1] 1,4-ALPHA-GLUCAN BRANCHING ENZYME
    e-151  44%  1m7xA  [b.1.18 - c.1.8 - b.71.1] 1,4-ALPHA-GLUCAN BRANCHING ENZYME
    e-148  44%  1m7xD  [b.1.18 - c.1.8 - b.71.1] 1,4-ALPHA-GLUCAN BRANCHING ENZYME
    e-146  44%  1m7xC  [b.1.18 - c.1.8 - b.71.1] 1,4-ALPHA-GLUCAN BRANCHING ENZYME
    4e-27  32%  1ehaA  [b.1.18 - c.1.8 - b.71.1] GLYCOSYLTREHALOSE TREHALOHYDROLASE
    4e-27  32%  1eh9A  [b.1.18 - c.1.8 - b.71.1] GLYCOSYLTREHALOSE TREHALOHYDROLASE
    1e-17  26%  2e8yA  [x.x.x] AMYX PROTEIN
    2e-17  28%  2bhuA  [x.x.x] MALTOOLIGOSYLTREHALOSE TREHALOHYDROLASE
    4e-17  32%  2vuyB  [x.x.x] GLYCOGEN OPERON PROTEIN GLGX
    4e-17  32%  2vuyA  [x.x.x] GLYCOGEN OPERON PROTEIN GLGX
    4e-17  32%  2vr5B  [x.x.x] GLYCOGEN OPERON PROTEIN GLGX
    4e-17  32%  2vr5A  [x.x.x] GLYCOGEN OPERON PROTEIN GLGX
    4e-17  32%  2vncB  [x.x.x] GLYCOGEN OPERON PROTEIN GLGX
    4e-17  32%  2vncA  [x.x.x] GLYCOGEN OPERON PROTEIN GLGX
    3e-13  25%  2wanA  [x.x.x] PULLULANASE
    3e-11  26%  3fawA  [x.x.x] RETICULOCYTE BINDING PROTEIN
    1e-10  29%  2bhzA  [x.x.x] MALTOOLIGOSYLTREHALOSE TREHALOHYDROLASE
    1e-10  29%  2bhyA  [x.x.x] MALTOOLIGOSYLTREHALOSE TREHALOHYDROLASE
    3e-10  32%  1j0jA  [b.1.18 - c.1.8 - b.71.1] NEOPULLULANASE
    3e-10  32%  1j0hA  [b.1.18 - c.1.8 - b.71.1] NEOPULLULANASE
    3e-10  25%  3faxA  [x.x.x] RETICULOCYTE BINDING PROTEIN
    6e-09  32%  1smaA  [b.1.18 - c.1.8 - b.71.1] MALTOGENIC AMYLASE
    6e-09  32%  1gviA  [b.1.18 - c.1.8 - b.71.1] MALTOGENIC AMYLASE
    3e-08  28%  1wzaA  [x.x.x] ALPHA-AMYLASE A
    3e-08  28%  2aaaA  [x.x.x] ALPHA-AMYLASE
    7e-08  32%  1bf2A  [x.x.x] ISOAMYLASE
    2e-07  31%  2taaA  [c.1.8 - b.71.1] TAKA-AMYLASE A
    3e-07  24%  1wzlA  [x.x.x] ALPHA-AMYLASE II
    3e-07  31%  2ze0A  [x.x.x] ALPHA-GLUCOSIDASE
    3e-07  31%  2wkgA  [x.x.x] ALPHA AMYLASE, CATALYTIC REGION
    3e-07  31%  2wcsA  [x.x.x] ALPHA AMYLASE, CATALYTIC REGION
    3e-07  31%  2wc7A  [x.x.x] ALPHA AMYLASE, CATALYTIC REGION
    3e-07  32%  1d7fA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    8e-07  24%  1jf5A  [b.1.18 - c.1.8 - b.71.1] ALPHA AMYLASE II
    1e-06  24%  1jf6A  [b.1.18 - c.1.8 - b.71.1] ALPHA AMYLASE II
    1e-06  24%  1wzmA  [x.x.x] ALPHA-AMYLASE II
    1e-06  32%  1v3kA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    1e-06  32%  1v3jA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    1e-06  32%  1pamA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    1e-06  24%  1bvzA  [b.1.18 - c.1.8 - b.71.1] PROTEIN (ALPHA-AMYLASE II)
    2e-06  25%  1wzkA  [x.x.x] ALPHA-AMYLASE II
    2e-06  31%  1ea9C  [b.1.18 - c.1.8 - b.71.1] CYCLOMALTODEXTRINASE
    2e-06  30%  2guyA  [x.x.x] ALPHA-AMYLASE A
    3e-06  28%  1qhoA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] ALPHA-AMYLASE
    4e-06  24%  1vfmA  [x.x.x] NEOPULLULANASE 2
    4e-06  24%  1g1yA  [b.1.18 - c.1.8 - b.71.1] ALPHA-AMYLASE II
    5e-06  33%  1vb9A  [b.1.18 - c.1.8 - b.71.1 (1jibA)] ALPHA-AMYLASE II
    5e-06  33%  1h3gA  [b.1.18 - c.1.8 - b.71.1] CYCLOMALTODEXTRINASE
    5e-06  32%  3edfA  [x.x.x] CYCLOMALTODEXTRINASE
    5e-06  32%  3edeA  [x.x.x] CYCLOMALTODEXTRINASE
    5e-06  32%  3eddA  [x.x.x] CYCLOMALTODEXTRINASE
    6e-06  31%  1uksA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    1e-05  31%  1uktA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    1e-05  32%  1g5aA  [c.1.8 - b.71.1] AMYLOSUCRASE
    1e-05  27%  3dhuB  [x.x.x] ALPHA-AMYLASE
    2e-05  32%  1rp8A  [x.x.x] ALPHA-AMYLASE TYPE 1 ISOZYME
    2e-05  32%  2qpuA  [x.x.x] ALPHA-AMYLASE TYPE A ISOZYME
    2e-05  32%  2qpsA  [x.x.x] ALPHA-AMYLASE TYPE A ISOZYME
    2e-05  32%  1mvyA  [c.1.8 - b.71.1] AMYLOSUCRASE
    2e-05  32%  1jgiA  [c.1.8 - b.71.1] AMYLOSUCRASE
    2e-05  32%  1ht6A  [c.1.8 - b.71.1] ALPHA-AMYLASE ISOZYME 1
    2e-05  32%  3bsgA  [x.x.x] ALPHA-AMYLASE TYPE A ISOZYME
    3e-05  34%  3bshA  [x.x.x] ALPHA-AMYLASE TYPE A ISOZYME
    5e-05  31%  1cgyA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    7e-05  32%  1tcmA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    7e-05  32%  1pj9A  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    7e-05  32%  1kckA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    7e-05  32%  1cxlA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN
    7e-05  32%  1cgwA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    7e-05  32%  1cgvA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    7e-05  32%  1cdgA  [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE
    9e-05  31%  1dtuA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN (CYCLODEXTRIN
    9e-05  29%  1cygA  [x.x.x] CYCLODEXTRIN GLUCANOTRANSFERASE
    2e-04  31%  1cgxA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    2e-04  29%  3bmvA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    2e-04  29%  1a47A  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
    2e-04  25%  1uokA  [x.x.x] OLIGO-1,6-GLUCOSIDASE
    2e-04  32%  1pezA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    2e-04  32%  1lwhA  [c.1.8 - b.71.1] 4-ALPHA-GLUCANOTRANSFERASE
    3e-04  31%  1kclA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    3e-04  32%  1d3cA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    6e-04  32%  1eo5A  [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN (CYCLODEXTRIN
    8e-04  27%  4cgtA  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
:640

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxHIYAYEFMGAHKACEEGIEGIRFTTWAPNAKSICVIGDFNYWQV
1m7xB           --------------------------HLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
1m7xA           --------------------------HLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
1m7xD           --------------------------HLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
1m7xC           --------------------------HLRPYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDG
1ehaA           ------------------------------------------------FTLWAPYQKSVKL-------KV
1eh9A           ------------------------------------------------FTLWAPYQKSVKL-------KV
2e8yA           ------------------------------------------------FKVWAPAATSAAV--KLSHPNK
2bhuA           ------------------------------------------GGAGTRFRLWTSTARTVAV-------RV
2vuyB           ----------------------------------------------------------------FNPNKV
2vuyA           ----------------------------------------------------------------FNPNKV
2vr5B           ----------------------------------------------------------------FNPNKV
2vr5A           ----------------------------------------------------------------FNPNKV
2vncB           ----------------------------------------------------------------FNPNKV
2vncA           ----------------------------------------------------------------FNPNKV
2wanA           ------------------------------YDYSGNDLGNVYSKDATSFRVWAPTASNVQLLLYNSEKGS
3fawA           ----------------------------------------------VEASLWSPSADSVTMI----IYDK
2bhzA           ------------------------------------------GGAGTRFRLWTSTARTVAV---------
2bhyA           ------------------------------------------GGAGTRFRLWTSTARTVAV---------
1j0jA           ----------------------------------------------------------------------
1j0hA           ----------------------------------------------------------------------
3faxA           ----------------------------------------------VEASLWSPSADSVTMI----IYDK
1smaA           ----------------------------------------------------------------------
1gviA           ----------------------------------------------------------------------
1wzaA           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
1bf2A           ----------------------------------------------------------------------
2taaA           ----------------------------------------------------------------------
1wzlA           ----------------------------------------------------------------------
2ze0A           ----------------------------------------------------------------------
2wkgA           ----------------------------------------------------------------------
2wcsA           ----------------------------------------------------------------------
2wc7A           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1jf5A           ----------------------------------------------------------------------
1jf6A           ----------------------------------------------------------------------
1wzmA           ----------------------------------------------------------------------
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1bvzA           ----------------------------------------------------------------------
1wzkA           ----------------------------------------------------------------------
1ea9C           ----------------------------------------------------------------------
2guyA           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1vfmA           ----------------------------------------------------------------------
1g1yA           ----------------------------------------------------------------------
1vb9A           ----------------------------------------------------------------------
1h3gA           ----------------------------------------------------------------------
3edfA           ----------------------------------------------------------------------
3edeA           ----------------------------------------------------------------------
3eddA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1g5aA           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1rp8A           ----------------------------------------------------------------------
2qpuA           ----------------------------------------------------------------------
2qpsA           ----------------------------------------------------------------------
1mvyA           ----------------------------------------------------------------------
1jgiA           ----------------------------------------------------------------------
1ht6A           ----------------------------------------------------------------------
3bsgA           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
1uokA           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1lwhA           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTNNYVYKSDPYAFFSELRPNTASIITTETQYTWS
1m7xB           R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAF--EAQPETASLICGLPEKVVQ
1m7xA           R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQMRPETASLICGLPEKVVQ
1m7xD           R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQM---TASLICGLPEKVVQ
1m7xC           R-RHPMRLRKESGIWELFIPGAHNGQLYKYEMIDAN-GNLRLKSDPYAFEAQ----TASLICGLPEKVVQ
1ehaA           LEKGLYEMERDEGYFTITLNNVKVRDRYKYVLDDASEI-----PDPASRYQPEGVHGPSQIIQESK-EFN
1eh9A           LEKGLYEMERDEGYFTITLNNVKVRDRYKYVLDDASEI-----PDPASRYQPEGVHGPSQIIQESK-EFN
2e8yA           SGRTFQMTRLEKGVYAVTVTGDLHGYEYLFCICNN--SEWMETVDQYAKAVTVNGEKGVVLRPDQMKWTA
2bhuA           NGTEHVMTSLGGGIYELELPVGP-GARYLFVLDGVPT------PDPYARFLPDGVHGEAEVVDFGTFDWT
2vuyB           LIDPYAKAINGSVIWNDAVFGYKIGDQNQLTYDERDSGEYVPKS----------------VVINPYFEWD
2vuyA           LIDPYAKAINGSVIWNDAVFGYKIGDQNQLTYDERDSGEYVPKS----------------VVINPYFEWD
2vr5B           LIDPYAKAINGSVIWNDAVFGYKIGDQNQLTYDERDSGEYVPKS----------------VVINPYFEWD
2vr5A           LIDPYAKAINGSVIWNDAVFGYKIGDQNQLTYDERDSGEYVPKS----------------VVINPYFEWD
2vncB           LIDPYAKAINGSVIWNDAVFGYKIGDQNQLTYDERDSGEYVPKS----------------VVINPYFEWD
2vncA           LIDPYAKAINGSVIWNDAVFGYKIGDQNQLTYDERDSGEYVPKS----------------VVINPYFEWD
2wanA           ITKQLEMQKSDNGTWKLQVSGNLENWYYLYQVTVNGTTQTAV--DPYARAISVNATRGMIVDLKATDPWQ
3fawA           DNQNRVVATTNKGVWQTILDTKKNYTGYYYLYEIKRGKDKVKILDPYASLAEWDSNTVNDDIKTAKAAFV
2bhzA           -RVNGTEHVTSGGIYELELPVGP-GARYLFVLDGVPT------PDPYARFLPDGVHGEAEVVDFGTFDWT
2bhyA           -RVNGTEHVTSGGIYELELPVGP-GARYLFVLDGVPT------PDPYARFLPDGVHGEAEVVDFGTFDWT
1j0jA           ----------------------------------------------------------------------
1j0hA           ----------------------------------------------------------------------
3faxA           DNQNRVVATTNKGVWQTILDTKKNYTGYYYLYEIK-RGDKVKILDPYASLAEWDSNTVNDDIKTAKAAFV
1smaA           ----------------------------------------------------------------------
1gviA           ----------------------------------------------------------------------
1wzaA           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
1bf2A           ----------------------------------------------------------------------
2taaA           ----------------------------------------------------------------------
1wzlA           ----------------------------------------------------------------------
2ze0A           ----------------------------------------------------------------------
2wkgA           ----------------------------------------------------------------------
2wcsA           ----------------------------------------------------------------------
2wc7A           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1jf5A           ----------------------------------------------------------------------
1jf6A           ----------------------------------------------------------------------
1wzmA           ----------------------------------------------------------------------
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1bvzA           ----------------------------------------------------------------------
1wzkA           ----------------------------------------------------------------------
1ea9C           ----------------------------------------------------------------------
2guyA           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1vfmA           ----------------------------------------------------------------------
1g1yA           ----------------------------------------------------------------------
1vb9A           ----------------------------------------------------------------------
1h3gA           ----------------------------------------------------------------------
3edfA           ----------------------------------------------------------------------
3edeA           ----------------------------------------------------------------------
3eddA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1g5aA           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1rp8A           ----------------------------------------------------------------------
2qpuA           ----------------------------------------------------------------------
2qpsA           ----------------------------------------------------------------------
1mvyA           ----------------------------------------------------------------------
1jgiA           ----------------------------------------------------------------------
1ht6A           ----------------------------------------------------------------------
3bsgA           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
1uokA           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1lwhA           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DDKWLEKRAKTNYYDNPMNVYELHLASWKTKNGKFLTYDELNETLPQYIKEMGYTHVEFMPLHEHPLDAS
1m7xB           T----EERKKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
1m7xA           T----EERKKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
1m7xD           T----EERKKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
1m7xC           T----EERKKANQFDAPISIYEVHLGSWRTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGS
1ehaA           NETFLKKE--------DLIIYEIHVGTFTPEG----TFEGVIRKL-DYLKDLGITAIEIMPIAQFPGKRD
1eh9A           NETFLKKE--------DLIIYEIHVGTFTPEG----TFEGVIRKL-DYLKDLGITAIEIMPIAQFPGKRD
2e8yA           PLKPFSHPVDAVIYETHLRDFSIHENSGMINKGKYLALTETDTQTANYVKELGVTHVELLPVNEKPLDAN
2bhuA           DADWHGIKLADCVF------YEVHVGTFTPEG----TYRAAAEKLP-YLKELGVTAIQVMPLAAFDGQRG
2vuyB           DEDFI-KGKKVPLKDTV--IYEVHVKGF-TKLRLDLTYEGLSEQMISYLKDLGITTVELMPLTDKGLTNY
2vuyA           DEDFI-KGKKVPLKDTV--IYEVHVKGF-TKLRLDLTYEGLSEQMISYLKDLGITTVELMPLTDKGLTNY
2vr5B           DEDFI-KGKKVPLKDTV--IYEVHVKGF-TKLRLDLTYEGLSEQMISYLKDLGITTVELMPLTDKGLTNY
2vr5A           DEDFI-KGKKVPLKDTV--IYEVHVKGF-TKLRLDLTYEGLSEQMISYLKDLGITTVELMPLTDKGLTNY
2vncB           DEDFI-KGKKVPLKDTV--IYEVHVKGF-TKLRLDLTYEGLSEQMISYLKDLGITTVELMPLTDKGLTNY
2vncA           DEDFI-KGKKVPLKDTV--IYEVHVKGF-TKLRLDLTYEGLSEQMISYLKDLGITTVELMPLTDKGLTNY
2wanA           GD---HEQTPANPVDEV--IYEAHVRDFSINKGKYLAFTEHGTKGPDHVKELGITTVQLQPVEEQPDTYN
3fawA           NPSQLGPQAKIANFKGRQDIYEAHVRDFKLKN-QLGTFAAFSEKL-DYLQKLGVTHIQLLPVYVNEMDKS
2bhzA           DADWHGIKLADCVF------YEVHVGTFTPEG----TYRAAAEKLP-YLKELGVTAIQ-VPLAAFDGQRG
2bhyA           DADWHGIKLADCVF------YEVHVGTFTPEG----TYRAAAEKLP-YLKELGVTAIQ-VPLAAFDGQRG
1j0jA           -----------------------------------------------YLVDLGITGIYLTPIFRSP--SN
1j0hA           -----------------------------------------------YLVDLGITGIYLTPIFRSP--SN
3faxA           NPSQLGPQAKIANFKGRQDIYEAHVRDFKNQLGTFAAFSEKLD----YLQKLGVTHIQLLPVYVNEMDKS
1smaA           -----------------------------------------------YLADLGITGIYLTPIFRAP--SN
1gviA           -----------------------------------------------YLADLGITGIYLTPIFRAP--SN
1wzaA           --------------------------------------DYLNDGDPETIADLGVNGIWLMPIFKSP--SY
2aaaA           -----------------------------------------------YIEGMGFTAIWISPITEQPQDAY
1bf2A           -----------------------------------------------YLASLGVTAVEFLPVQETQNDAN
2taaA           -----------------------------------------------YIQGMGFTAIWITPVTAQPQDCA
1wzlA           -----------------------------------------------YLEELGVTALYFTPIFASP--SH
2ze0A           -----------------------------------------------YLVELGVDIVWICPIYRSP-NAD
2wkgA           -----------------------------------------------YIQNLGINAIYFTPIFQSA--SN
2wcsA           -----------------------------------------------YIQNLGINAIYFTPIFQSA--SN
2wc7A           -----------------------------------------------YIQNLGINAIYFTPIFQSA--SN
1d7fA           ----------------------------------------------------------------------
1jf5A           -----------------------------------------------YLEELGVTALYFTPIFASP--SH
1jf6A           -----------------------------------------------YLEELGVTALYFTPIFASP--SH
1wzmA           -----------------------------------------------YLEELGVTALYFTPIFASP--SH
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1bvzA           -----------------------------------------------YLEELGVTALYFTPIFASP--SH
1wzkA           -----------------------------------------------YLEELGVTALYFTPIFASP--SH
1ea9C           -----------------------------------------------HLSKLGVNAVYFTPLFKATTNHK
2guyA           -----------------------------------------------YIQGMGFTAIWITPVTAQLPDAY
1qhoA           --------------NNPAKSYGLYKSKWKMYWGGDL--EGVRQKLP-YLKQLGVTTIWLSPVLDN-LDTL
1vfmA           -----------------------------------------------YLEELGVTALYFTPIFASP--SH
1g1yA           -----------------------------------------------YLEELGVTALYFTPIFASP--SH
1vb9A           -----------------------------------------------YLEELGVTALYFTPIFASP--SH
1h3gA           -----------------------------------------------YIAGLGFTQLWPTPLVENDAAAY
3edfA           -----------------------------------------------YIAGLGFTQLWPTPLVENDAAAY
3edeA           -----------------------------------------------YIAGLGFTQLWPTPLVENDAAAY
3eddA           -----------------------------------------------YIAGLGFTQLWPTPLVENDAAAY
1uksA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1g5aA           ----------------------------------------LKDKIP-YFQELGLTYLHLMPLFKCPEGKS
3dhuB           ----------------------------------------------QRIKDLGTDILWLLPINEVNRKGT
1rp8A           --------------------------SWKQSGGWYMMMGKVDD-----IAAAGVTHV-WLPPPSHSV-SN
2qpuA           --------------------------SWKQSGGWYMMMGKVDD-----IAAAGVTHV-WLPPPSHSV-SN
2qpsA           --------------------------SWKQSGGWYMMMGKVDD-----IAAAGVTHV-WLPPPSHSV-SN
1mvyA           ----------------------------------------LKDKIP-YFQELGLTYLYLMPLFKCPEGKS
1jgiA           ----------------------------------------LKDKIP-YFQELGLTYLYLMPLFKCPEGKS
1ht6A           --------------------------SWKQSGGWYMMMGKVDD-----IAAAGVTHV-WLPPPSHSV-SN
3bsgA           --------------------------SWKQSGGWYMMMGKVDD-----IAAAGVTHV-WLPPPSHSV-SN
3bshA           --------------------------SWKQSGGWYMMMGKVDD-----IAAAGVTHV-WLPPPSHSV-SN
1cgyA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
1cygA           ----------------------------------------INKINDGYLTDMGVTAIVFSVMNDASGSAS
1cgxA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
1uokA           -------------------VYQIYPRSFMDSNGDGI--GDLRGIISKYLKELGIDVIWLSPVYESPNDDN
1pezA           ----------------------------------------------------------------------
1lwhA           -----------------------------------------------YLKELGIDFVWLMPVFSSI--SF
1kclA           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           WGYQPTGFYSVNSRHGDIIGLKRLVDKLHNNDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAIN
1m7xB           WGYQPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDDFALAEFDGTNLYEHS-------
1m7xA           WGYQPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDDFALAEFDGTNLYEHS-------
1m7xD           WGYQPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDDFALAEFDGTNLYEHSN------
1m7xC           WGYQPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDDFALAEFDGTNLYEH--------
1ehaA           WGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTP-----
1eh9A           WGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTP-----
2e8yA           WGYNPLHFFAPEGSYASKTELKQMINTLHQHGLRVILDVVFNHVYKRENSPFYF-----FRHDECGKPSN
2bhuA           WXXXXXXXXXXXXXXXXXEDLMALVDAAHRLGLGVFLDVVYNHFGPSGNYLSSY--APSYF----TDRFS
2vuyB           WGYDPINFFSPECRYGQVLSFKKMVNELHNAGIEVIIDVVYNHTAEGNHSFRGIDNTAYYMLQPDNKRYY
2vuyA           WGYDPINFFSPECRYGQVLSFKKMVNELHNAGIEVIIDVVYNHTAEGNHSFRGIDNTAYYMLQPDNKRYY
2vr5B           WGYDPINFFSPECRYGQVLSFKKMVNELHNAGIEVIIDVVYNHTAEGNHSFRGIDNTAYYMLQPDNKRYY
2vr5A           WGYDPINFFSPECRYGQVLSFKKMVNELHNAGIEVIIDVVYNHTAEGNHSFRGIDNTAYYMLQPDNKRYY
2vncB           WGYDPINFFSPECRYGQVLSFKKMVNELHNAGIEVIIDVVYNHTAEGNHSFRGIDNTAYYMLQPDNKRYY
2vncA           WGYDPINFFSPECRYGQVLSFKKMVNELHNAGIEVIIDVVYNHTAEGNHSFRGIDNTAYYMLQPDNKRYY
2wanA           WGYDPRNYNVPEGAYATITELKQLIQSLHQQRIGVNMDVVYNHMVSDFDKIV-----PQYYYRDXXXXXX
3fawA           WGYDPQSYFALSGMYSEIAELKQLIHDIHKRGMGVILDVVYNHTAKT---YLFEDIEPYYHFMNEDGSPR
2bhzA           WXXXXXXXXXXXXXXXXXEDLA-LVDAAHRLGLGVFLDVVYNHFGPSGNYLSSY--APSYF----TDRFS
2bhyA           WXXXXXXXXXXXXXXXXXEDLA-LVDAAHRLGLGVFLDVVYNHFGPSGNYLSSY--APSYF----TDRFS
1j0jA           HKYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHVWKNGESSKYKDWFHIHEFPLQTEP-R
1j0hA           HKYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHVWKNGESSKYKDWFHIHEFPLQTEP-R
3faxA           WGYDPQSYFALSGMYSEIAELKQLIHDIHKRGMGVILDVVYNHTAKT---YLFEDIEPYYHFMNEDGSPR
1smaA           HKYDTADYFEIDPHFGDKETLKTLVKRCHEKGIRVMLDAVFNHVLKNGAASRYKDWFHIREFPLQTEP-R
1gviA           HKYDTADYFEIDPHFGDKETLKTLVKRCHEKGIRVMLDAVFNHVLKNGAASRYKDWFHIREFPLQTEP-R
1wzaA           HGYDVTDYYKINPDYGTLEDFHKLVEAAHQRGIKVIID-LPINHTSERHPWFLLDGGRVWHYSPTGMYYG
2aaaA           HGYWQQKIYDVNSNFGTADNLKSLSDALHARGMYLMVDVVPDHMGYAGNGYSVFDPFDSSSYFHPLTMVE
1bf2A           WGYMTENYFSPDRRYGPTAEFQAMVQAFHNAGIKVYMDVVYNHTAEGTTATIYLDNATYYELTSGNQYFN
2taaA           YGYWQTDIYSLNENYGTADDLKALSSALHERGMYLMVDVVANHMGYDGAGVDYSVFKPCFNYEDQTQVED
1wzlA           HKYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAYKDWFFIEDFPVSKTSRTNYETFAVQ
2ze0A           NGYDISDYYAIMDEFGTMDDFDELLAQAHRRGLKVILDLVINH-TSDEHWYIWRDGGSAWQYDERTGQ--
2wkgA           HRYHTHDYYQVDPMLGGNEAFKELLDAAHQRNIKVVLDGVFNH---SSRGFFFFEGWPLSPYNGEFPANY
2wcsA           HRYHTHDYYQVDPMLGGNEAFKELLDAAHQRNIKVVLDGVFNH---SSRGFFFFEGWPLSPYNGEFPANY
2wc7A           HRYHTHDYYQVDPMLGGNEAFKELLDAAHQRNIKVVLDGVFNH---SSRGFFFFEGWPLSPYNGEFPANY
1d7fA           -GYWARDFKKTNPAYGTMQDFKNLIDTAHAHNIKVIIDFAPNHTSPAENGRLYDNGNLLGGYTNDTQNLF
1jf5A           HKYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAYKDWFFIEDFPVSKTSRTNYETAAVQ
1jf6A           HKYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAYKDWFFIEDFPVSKTSRTNYETYAVQ
1wzmA           HKYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAYKDWFFIEDFPVSKTSRTNYETFAVQ
1v3kA           -GYWARDFKKTNPAYGTMQDFKNLIDTAHAHNIKVIIDFAPNHTSPAENGRLYDNGNLLGGYTNDTQNLF
1v3jA           -GYWARDFKKTNPAYGTMQDFKNLIDTAHAHNIKVIIDFAPNHTSPAENGRLYDNGNLLGGYTNDTQNLF
1pamA           -GYWARDFKKTNPAYGTMQDFKNLIDTAHAHNIKVIIDFAPNHTSPAENGRLYDNGNLLGGYTNDTQNLF
1bvzA           HKYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAYKDWFFIEDFPVSKTSRTNYETFAVQ
1wzkA           HKYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAYKDWFFIEDFPVSKTSRTNYETFAVQ
1ea9C           --YDTEDYFQIDPQFGDKDTLKKLVDLCHERGIRVLLDAVFNHFHIRSLPLEVVDGIPTYDTFAFEPLMP
2guyA           HGYWQQDIYSLNENYGTADDLKALSSALHERGMYLMVDVVANHMGYDGAGVDYSVFKPCFNYEDQTQVED
1qhoA           AGTDNTGYHGIEEHFGNWTTFDTLVNDAHQNGIKVIVDFVPNHSTPAEGGALYNNGTYMGNYFDDA---T
1vfmA           HKYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAYKDWFFIEDFPVSKTSRTNYETFAVQ
1g1yA           HKYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAYKDWFFIEDFPVSKTSRTNYETFAVQ
1vb9A           HKYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNH---------------------------
1h3gA           HGYAATDHYRIDPRYGDFVRLSTEARKRGGLIQDVVLDWINGKFVPTQHHRVAVQDP--YAAQADSENFT
3edfA           HGYAATDHYRIDPRYGSNEDFVRLSTEARKRGMGLIQDWIGGKFVPTQHHRVAVQDP--YAAQADSENFT
3edeA           HGYAATDHYRIDPRYGSNEDFVRLSTEARKRGMGLIQDWIGGKFVPTQHHRVAVQDP--YAAQADSENFT
3eddA           HGYAATDHYRIDPRYGSNEDFVRLSTEARKRGMGLIQDWIGGKFVPTQHHRVAVQDP--YAAQADSENFT
1uksA           -GYWARDFKKTNPAYGTMQDFKNLIDTAHAHNIKVIIDFAPNHTSPAENGRLYDNGNLLGGYTNDTQTIE
1uktA           -------FKKTNPAYGTMQDFKNLIDTAHAHNIKVIIDFAPNHTSPAENGRLYDNGNLLGGYTNDTQNLF
1g5aA           GGYAVSSYRDVNPALGTIGDLREVIAALHEAGISAVVDFIFNH---------------------------
3dhuB           LGYAIKDYRGINPEYGTLADFKALTDRAHELGMKVMLDIVYNHTSPDS---VLATEHPEWFYHDLTNKVG
1rp8A           EGYMPGRLYDIDSKYGNAAELKSLIGALHGKGVQAIADIVINHRCAD-----YKDSRGIYIFEGGTSDGR
2qpuA           EGYMPGRLYDIDSKYGNAAELKSLIGALHGKGVQAIADIVINHRCAD-----YKDSRGIYIFEGGTSDGR
2qpsA           EGYMPGRLYDIDSKYGNAAELKSLIGALHGKGVQAIADIVINHRCAD-----YKDSRGIYIFEGGTSDGR
1mvyA           GGYAVSSYRDVNPALGTIGDLREVIAALHEAGISAVVDFIFNH---------------------------
1jgiA           GGYAVSSYRDVNPALGTIGDLREVIAALHEAGISAVVDFIFNH---------------------------
1ht6A           EGYMPGRLYDIDSKYGNAAELKSLIGALHGKGVQAIADIVINHRCAD-----YKDSRGIYIFEGGTSDGR
3bsgA           EGYMPGRLYDIDSKYGNAAELKSLIGALHGKGVQAIADIVINHRCAD-----YKDSRGIYIFEGGTSDGR
3bshA           EGYMPGRLYDIDSKYGNAAELKSLIGALHGKGVQAIADIVINHRCAD-----YKDGIACI-FEGGTSDGR
1cgyA           -GYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHASSDQNGRLYDNGTLLGGYTNDTQNLN
1tcmA           -GYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHASSDQNGRLYDNGTLLGGYTNDTQNLF
1pj9A           -GYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHASSDQNGRLYDNGTLLGGYTNDTQNLF
1kckA           -GYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHASSDQNGRLYDNGTLLGGYTNDTQNLF
1cxlA           -GYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHASSDQNGRLYDNGTLLGGYTNDTQNLF
1cgwA           -GYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHASSDQNGRLYDNGTLLGGYTNDTQNLF
1cgvA           -GYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHASSDQNGRLYDNGTLLGGYTNDTQNLF
1cdgA           -GYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHASSDQNGRLYDNGTLLGGYTNDTQNLF
1dtuA           -GYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPAENGRLYDNGTLLGGYTNDTQNLF
1cygA           YGYWARDFKKPNPFFGTLSDFQRLVDAAHAKGIKVIIDFAPNHTSPAENGRLYDNGTLLGGYTNDASSLE
1cgxA           -GYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHASSDQNGRLYDNGTLLGGYTNDTQNLF
3bmvA           -GYWARDFKRTNPYFGSFTDFQNLINTAHAHNIKVIIDFAPNHTSPAENGRLYDNGTLLGGYTNDTNGYF
1a47A           -GYWARDFKRTNPYFGSFTDFQNLINTAHAHNIKVIIDFAPNHTSPAENGRLYDNGTLLGGYTNDTNGYF
1uokA           -GYDISDYCKIMNEFGTMEDWDELLHEMHERNMKLMMDLVVNH-TSDEH---------------------
1pezA           -GYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHASSDQNGRLYDNGTLLGGYTNDTQNLF
1lwhA           HGYDVVDFYSFKAEYGSEREFKEMIEAFHDSGIKVVLD--------------------------------
1kclA           -GYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHASSDQNGRLYDNGTLLGGYTNDTQNLE
1d3cA           -GYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHASSDQNGRLYDNGTLLGGYTNDTQNLF
1eo5A           -GYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHASSDQNGRLYDNGTLLGGYTNDTQNLF
4cgtA           -GYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTADAENGRLYDNGTLVGGYTNDTNGYF


                         .         *         .         .         .         .         +:350
query           KGWGTHNFDLGRNEVKCFLISNAMYWINEFHIDGLRVDAVSNILYLNYDREDGQWIPNIYGGHENLEGIA
1m7xB           ----TLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVASMIYRD--------IPNEFGGRENLEAIE
1m7xA           ----TLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVASMIYR--------------GGRENLEAIE
1m7xD           ----TLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVASMIYRD--------------GRENLEAIE
1m7xC           ----SLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVASMIY-----------------RENLEAIE
1ehaA           --WGTFNFDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAII--------------------DTSPKH
1eh9A           --WGTFNFDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAII--------------------DTSPKH
2e8yA           GTGVGNDIASERRMARKFIADCVVYWLEEYNVDGFRFDLIDTVLYM------------------------
2bhuA           SAWGM-GLDYAEPHMRRYVTGNARMWLRDYHFDGLRLDATP---YMTDDSETAQEIHELGGDHRNLPDLV
2vuyB           LDFGTGNLNLSHPRVIQMVLDSLRYWVTEMHVDGFRFD--------------------------------
2vuyA           LDFGTGNLNLSHPRVIQMVLDSLRYWVTEMHVDGFRFD--------------------------------
2vr5B           LDFGTGNLNLSHPRVIQMVLDSLRYWVTEMHVDGFRFD--------------------------------
2vr5A           LDFGTGNLNLSHPRVIQMVLDSLRYWVTEMHVDGFRFD--------------------------------
2vncB           LDFGTGNLNLSHPRVIQMVLDSLRYWVTEMHVDGFRFD--------------------------------
2vncA           LDFGTGNLNLSHPRVIQMVLDSLRYWVTEMHVDGFRFD--------------------------------
2wanA           XXXXXXEFATEHPMAQKFVLDSVNYWVNEYHVDGFRFDLMA-----------------------------
3fawA           ESFGGGRLGTTHAMSRRVLVDSIKYLTSEFKVDGFRFDMMGD----------------------------
2bhzA           SAWGGLDY---AEPHRRYVTGNAR-WLRDYHFDGLRLDA-------------------------------
2bhyA           SAWGGLDY---AEPHRRYVTGNAR-WLRDYHFDGLRLDA-------------------------------
1j0jA           PNYDTFAFNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEI---------------------------
1j0hA           PNYDTFAFNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEI---------------------------
3faxA           ESFGGGRLGTTHAMSRRVLVDSIKYLTSEFKVDGFRFDMMGD----------------------------
1smaA           PNYDTFAFNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANEI---------------------------
1gviA           PNYDTFAFNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANEI---------------------------
1wzaA           YFWGMPDLNYNNPEVQEKVIGIAKYWLKQ-GVDGFRLDGAMHIFPAQYDKNFTWW---------------
2aaaA           DCWSLPDLDTTETAVRTIWYDWVADLVSNYSVDGLRIDSVLEVFFPGYNKASGVYCVGEIDNGNPASDCP
1bf2A           TGIGA-NFNTYNTVAQNLIVDSLAYWANTMGVDGFRFDLAS-----------------------------
2taaA           CWLGDNTVSLPDLDTTKDVVKNEWYWVSNYSIDGLRIDTVKHV---------------------------
1wzlA           VP-AMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLDVANEVDH------------------------A
2ze0A           --YYLHIFDVKQSEVRQALYEMVNWWLDK-GIDGFRIDAISHIXXXXXXXXXXXXYVPSFAGHMNQPGIE
2wkgA           VGWAGNEFNHDNPEVREYIMEIAEYWL-KFGIDGWRLD--------------------------------
2wcsA           VGWAGNEFNHDNPEVREYIMEIAEYWL-KFGIDGWRLD--------------------------------
2wc7A           VGWAGNEFNHDNPEVREYIMEIAEYWL-KFGIDGWRLD--------------------------------
1d7fA           HHYGGTDFDLNHNSVDVYLKDAIKMWL-DLGVDGIRVDAVKNM---------------------------
1jf5A           VP-AMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLDVANEVDH------------------------A
1jf6A           VP-AMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLDVANEVDH------------------------A
1wzmA           VP-AMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLDVANEVDH------------------------A
1v3kA           HHYGGTDFDLNHNSVDVYLKDAIKMWL-DLGVDGIRVDAVKHM---------------------------
1v3jA           HHYGGTDFDLNHNSVDVYLKDAIKMWL-DLGVDGIRVDAVKHM---------------------------
1pamA           HHYGGTDFDLNHNSVDVYLKDAIKMWL-DLGVDGIRVDAVKHM---------------------------
1bvzA           VP-AMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLDVANEVDH------------------------A
1wzkA           VP-AMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLDVANEVDH------------------------A
1ea9C           K------LNTEHPDVKEYLLKAAEYWIRETGIDGWRLDVANEV---------------------------
2guyA           CWLGDNTVSLPDLDTTKDVVKNEWYWVSNYSIDGLRIDTVKHV---------------------------
1qhoA           KGYFHHNGDISENGTIAQYLTDAAVQLVAHGADGLRIDAVKSLADKLYQKKDGEWYGDDPGTANHLEKVR
1vfmA           VP-AMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLNVANEVDH------------------------A
1g1yA           VP-AMPKLRTENPEVKEYLFDVARFWM-EQGIDGWRLDVANEVDH------------------------A
1vb9A           ----------------------------------------------------------------------
1h3gA           KGWFVEGPDLNQTNVANYLIQNNIWWIEYAGLSGLRID--------------------------------
3edfA           KGWFVEGMDLNQTNVANYLIQNNIWWIEYAGLSGLRID--------------------------------
3edeA           KGWFVEGMDLNQTNVANYLIQNNIWWIEYAGLSGLRID--------------------------------
3eddA           KGWFVEGMDLNQTNVANYLIQNNIWWIEYAGLSGLRID--------------------------------
1uksA           NGIYKNLYDLNNSSVDVYLKDAIKMWL-DLGVDGIRVDAVKHM---------------------------
1uktA           HHYGGTDFDLNHNSVDVYLKDAIKMWL-DLGVDGIRVDAVKHM---------------------------
1g5aA           ----------------------------------------------------------------------
3dhuB           DWSDVKDLDYGHHELWQYQIDTLLYW-SQF-VDGYRCD--------------------------------
1rp8A           LDWGPH----------------------------------------------------------------
2qpuA           LDWGPH----------------------------------------------------------------
2qpsA           LDWGPH----------------------------------------------------------------
1mvyA           ----------------------------------------------------------------------
1jgiA           ----------------------------------------------------------------------
1ht6A           LDWGPH----------------------------------------------------------------
3bsgA           LDWGPH----------------------------------------------------------------
3bshA           LDWGPH----------------------------------------------------------------
1cgyA           GGWDLADLNHNNSTVDVYLKDAIKMWL-DLGIDGIRMDAVKHM---------------------------
1tcmA           HHNGGTDFDLNHNNVDVYLKDAIKMWL-DLGIDGIRMDAVKHM---------------------------
1pj9A           HHNGGTDFDLNHNNVDVYLKDAIKMWL-DLGIDGIRMDAVKHM---------------------------
1kckA           HHNGGTDFDLNHNNVDVYLKDAIKMWL-DLGIDGIRMDAVKHM---------------------------
1cxlA           HHNGGTDFDLNHNNVDVYLKDAIKMWL-DLGIDGIRMDAVKHM---------------------------
1cgwA           HHNGGTDFDLNHNNVDVYLKDAIKMWL-DLGIDGIRMDAVKHM---------------------------
1cgvA           HHNGGTDFDLNHNNVDVYLKDAIKMWL-DLGIDGIRMDAVKHM---------------------------
1cdgA           HHNGGTDFDLNHNNVDVYLKDAIKMWL-DLGIDGIRMDAVKHM---------------------------
1dtuA           HHNGGTDFDLNHNNVDVYLKDAIKMWL-DLGIDGIRMDAVKHM---------------------------
1cygA           DGIYRNLFDLAQNPVIDRYLKDAVKMWIDMGIDGIRMDAVKHM---------------------------
1cgxA           HHNGGTDFSTTENTVDVYLKDAIKMWL-DLGIDGIRMDAVKHM---------------------------
3bmvA           HHYGGTDFDLNQSTIDSYLKSAIKVWL-DMGIDGIRLDAVKHM---------------------------
1a47A           HHYGGTDFDLNQSTIDSYLKSAIKVWL-DMGIDGIRLDAVKHM---------------------------
1uokA           ----------------------------------------------------------------------
1pezA           HHNGGTDFDLNHNNVDVYLKDAIKMWL-DLGIDGIRMDVVKHM---------------------------
1lwhA           ----------------------------------------------------------------------
1kclA           NGIYKNLYDLNNSTVDVYLKDAIKMWL-DLGIDGIRMDAVKHM---------------------------
1d3cA           HHNGGTDFDLNHNNVDVYLKDAIKMWL-DLGIDGIRMNAVKHM---------------------------
1eo5A           HHNGGTDFDLNHNNVDVYLKDAIKMWL-DLGIDGIRMAAVKHM---------------------------
4cgtA           HHNGGSDFSSLENDLADFNHNNAKLWL-DMGVDGIRVDAVKH-MPLGWQK---SWMSSIY----------


                         .         .         .         .         *         .         .:420
query           FLKELNGVLKHTCKGVITIAEESSSWPDISTPVEKGGLGFDFKWNMGWMNDTLRYISLDPVYRKYHHNLI
1m7xB           FLRNTNRILGEQVSGAVTMAEESTDFPGVSRPQDMGGLGFWYKWNLGWMHDTLDYMKLDPVYRQYHHDKL
1m7xA           FLRNTNRILGEQVSGAVTMAEESTDFPGVSRPQDMGGLGFWYKWNLGWMHDTLDYMKLDPVYRQYHHDKL
1m7xD           FLRNTNRILGEQVSGAVTMAEESTDFPGVSRPQDMGGLGFWYKWNLGWMHDTLDYMKLDPVYRQYHHDKL
1m7xC           FLRNTNRILGEQVSGAVTMAEESTDFPGVSRPQDMGGLGFWYKWNLGWMHDTLDYMKLDPVYRQYHHDKL
1ehaA           ILEEIADVVHKYNR--IVIAESDLNDPRVVNPKEKVGYNIDAQW--------------------------
1eh9A           ILEEIADVVHKYNR--IVIAESDLNDPRVVNPKEKCGYNIDAQW--------------------------
2e8yA           ----------------------------------------------------------------------
2bhuA           TVNHLDGI--------------------------------------------------------------
2vuyB           ----------------------------------------------------------------------
2vuyA           ----------------------------------------------------------------------
2vr5B           ----------------------------------------------------------------------
2vr5A           ----------------------------------------------------------------------
2vncB           ----------------------------------------------------------------------
2vncA           ----------------------------------------------------------------------
2wanA           ----------------------------------------------------------------------
3fawA           ----------------------------------------------------------------------
2bhzA           ----------------------------------------------------------------------
2bhyA           ----------------------------------------------------------------------
1j0jA           ----------------------------------------------------------------------
1j0hA           ----------------------------------------------------------------------
3faxA           ----------------------------------------------------------------------
1smaA           ----------------------------------------------------------------------
1gviA           ----------------------------------------------------------------------
1wzaA           ----------------------------------------------------------------------
2aaaA           YQKVLDGVLNYPIYWQLLYAFESSS---------------------------------------------
1bf2A           ----------------------------------------------------------------------
2taaA           ----------------------------------------------------------------------
1wzlA           FWREFRRLVKSLNPDALIVGE---IWHDASGWLM--GDQFDSVMNYLFRESVIRFFATGEIHAERFDAEL
2ze0A           YLREL-----------------------------------------------------------------
2wkgA           ----------------------------------------------------------------------
2wcsA           ----------------------------------------------------------------------
2wc7A           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1jf5A           FWREFRRLVKSLNPDALIVGE---IWHDASGWLM--GDQFDSVMNYLFRESVIRFFATGEIHAERFDAEL
1jf6A           FWREFRRLVKSLNPDALIVGE---IWHDASGWLM--GDQFDSVMNYLFRESVIRFFATGEIHAERFDAEL
1wzmA           FWREFRRLVKSLNPDALIVGE---IWHDASGWLM--GDQFDSVMNYLFRESVIRFFATGEIHAERFDAEL
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1bvzA           FWREFRRLVKSLNPDALIVGE---IWHDASGWLM--GDQFDSVMNYLFRESVIRFFATGEIHAERFDAEL
1wzkA           FWREFRRLVKSLNPDALIVGE---IWHDASGWLM--GDQFDSVMNYLFRESVIRFFATGEIHAERFDAEL
1ea9C           ----------------------------------------------------------------------
2guyA           ----------------------------------------------------------------------
1qhoA           YANNSGNVLDFDLNTVIVFGTFTQTMYDLNNMVNQTGNEYKYKENLITFHDMSRFLSVNSNKANLHQAL-
1vfmA           FWREFRRLVKSLNPDALIVGE---IWHDASGWLM--GDQFDSVMNYLFRESVIRFFATGEIHAERFDAEL
1g1yA           FWREFRRLVKSLNPDALIV---GAIWHDASGWLM--GDQFDSVMNYLFRESVIRFFATGEIHAERFDAEL
1vb9A           ----------------------------------------------------------------------
1h3gA           ----------------------------------------------------------------------
3edfA           ----------------------------------------------------------------------
3edeA           ----------------------------------------------------------------------
3eddA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1g5aA           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1rp8A           ----------------------------------------------------------------------
2qpuA           ----------------------------------------------------------------------
2qpsA           ----------------------------------------------------------------------
1mvyA           ----------------------------------------------------------------------
1jgiA           ----------------------------------------------------------------------
1ht6A           ----------------------------------------------------------------------
3bsgA           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
1uokA           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1lwhA           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TFSMVYHYSEKFILSISHDEVVHGKKSLINKMWGDLWNKYAGLRLYMSYMIGHPGKKLIFMGSEFVQFVE
1m7xB           TFGILYNYTENFVLPLSHDEVVHGKKSILDRMPGDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGRE
1m7xA           TFGILYNYTENFVLPLSHDEVVHGKKSILDRMPGDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGRE
1m7xD           TFGILYNYTENFVLPLSHDEVVHGKKSILDRMPGDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGRE
1m7xC           TFGILYNYTENFVLPLSHDEVVHGKKSILDRMPGDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGRE
1ehaA           ----------------------------------------------------------------------
1eh9A           ----------------------------------------------------------------------
2e8yA           ----------------------------------------------------------------------
2bhuA           ----------------------------------------------------------------------
2vuyB           ----------------------------------------------------------------------
2vuyA           ----------------------------------------------------------------------
2vr5B           ----------------------------------------------------------------------
2vr5A           ----------------------------------------------------------------------
2vncB           ----------------------------------------------------------------------
2vncA           ----------------------------------------------------------------------
2wanA           ----------------------------------------------------------------------
3fawA           ----------------------------------------------------------------------
2bhzA           ----------------------------------------------------------------------
2bhyA           ----------------------------------------------------------------------
1j0jA           ----------------------------------------------------------------------
1j0hA           ----------------------------------------------------------------------
3faxA           ----------------------------------------------------------------------
1smaA           ----------------------------------------------------------------------
1gviA           ----------------------------------------------------------------------
1wzaA           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
1bf2A           ----------------------------------------------------------------------
2taaA           ----------------------------------------------------------------------
1wzlA           TRARML-YPEQAAQGLWNLLDSHDTERFLTSCGGN----EAKFRLAVLFQMTYLGTPLIYYGDE-IGMAG
2ze0A           ----------------------------------------------------------------------
2wkgA           ----------------------------------------------------------------------
2wcsA           ----------------------------------------------------------------------
2wc7A           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1jf5A           TRARML-YPEQAAQGLWNLLDSHDTERFLTSCGGN----EAKFRLAVLFQMTYLGTPLIYYGDE-IGMAG
1jf6A           TRARML-YPEQAAQGLWNLLDSHDTERFLTSCGGN----EAKFRLAVLFQMTYLGTPLIYYGDE-IGMAG
1wzmA           TRARML-YPEQAAQGLWNLLDSHDTERFLTSCGGN----EAKFRLAVLFQMTYLGTPLIYYGDE-IGMAG
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1bvzA           TRARML-YPEQAAQGLWNLLDSHDTERFLTSCGGN----EAKFRLAVLFQMTYLGTPLIYYGDE-IGMAG
1wzkA           TRARML-YPEQAAQGLWNLLDSHDTERFLTSCGGN----EAKFRLAVLFQMTYLGTPLIYYGDEIGMAMI
1ea9C           ----------------------------------------------------------------------
2guyA           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1vfmA           TRARML-YPEQAAQGLWNLLDSHNTERFLTSCGGN----EAKFRLAVLFQMTYLGTPLIYYGDE-IGMAG
1g1yA           TRARML-YPEQAAQGLWNLLDSHDTERFLTSCGGN----EAKFRLAVLFQMTYLGTPLIYYGDE-IGMAG
1vb9A           ----------------------------------------------------------------------
1h3gA           ----------------------------------------------------------------------
3edfA           ----------------------------------------------------------------------
3edeA           ----------------------------------------------------------------------
3eddA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1g5aA           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1rp8A           ----------------------------------------------------------------------
2qpuA           ----------------------------------------------------------------------
2qpsA           ----------------------------------------------------------------------
1mvyA           ----------------------------------------------------------------------
1jgiA           ----------------------------------------------------------------------
1ht6A           ----------------------------------------------------------------------
3bsgA           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
1uokA           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1lwhA           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           WREYEQLQWQVVDQYESHKQTLHFFKKLNDLYHNETALWQCDYDHHGFRWIDADNSQQSILSFIRSSKDN
1m7xB           WNHDASLDWHLLEGGDNHHGVQRLVRDLNLTYRHHKAMHELDFDPYGFEWLVVDDKERSVLIFVRRDKEG
1m7xA           WNHDASLDWHLLEGGDNHHGVQRLVRDLNLTYRHHKAMHELDFDPYGFEWLVVDDKERSVLIFVRRDKEG
1m7xD           WNHDASLDWHLLEGGDNHHGVQRLVRDLNLTYRHHKAMHELDFDPYGFEWLVVDDKERSVLIFVRRDKEG
1m7xC           WNHDASLDWHLLEGGDNHHGVQRLVRDLNLTYRHHKAMHELDFDPYGFEWLVVDDKERSVLIFVRRDKEG
1ehaA           ----------------------------------------------------------------------
1eh9A           ----------------------------------------------------------------------
2e8yA           ----------------------------------------------------------------------
2bhuA           ----------------------------------------------------------------------
2vuyB           ----------------------------------------------------------------------
2vuyA           ----------------------------------------------------------------------
2vr5B           ----------------------------------------------------------------------
2vr5A           ----------------------------------------------------------------------
2vncB           ----------------------------------------------------------------------
2vncA           ----------------------------------------------------------------------
2wanA           ----------------------------------------------------------------------
3fawA           ----------------------------------------------------------------------
2bhzA           ----------------------------------------------------------------------
2bhyA           ----------------------------------------------------------------------
1j0jA           ----------------------------------------------------------------------
1j0hA           ----------------------------------------------------------------------
3faxA           ----------------------------------------------------------------------
1smaA           ----------------------------------------------------------------------
1gviA           ----------------------------------------------------------------------
1wzaA           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
1bf2A           ----------------------------------------------------------------------
2taaA           ----------------------------------------------------------------------
1wzlA           ATDPDCLRPMIWEEKEQNRGLFEFYKELIRLRHRLASL-----TRGNVRSWHAD-KQANLYAFVRTVQD-
2ze0A           ----------------------------------------------------------------------
2wkgA           ----------------------------------------------------------------------
2wcsA           ----------------------------------------------------------------------
2wc7A           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1jf5A           ATDPDCRRPMIWEEKEQNRGLFEFYKELIRLRHRLASL-----TRGNVRSWHAD-KQANLYAFVRTVQD-
1jf6A           ATDPDCRRPMIWEEKEQNRGLFEFYKELIRLRHRLASL-----TRGNVRSWHAD-KQANLYAFVRTVQD-
1wzmA           ATDPDCKRPMIWEEKEQNRGLFEFYKELIRLRHRLASL-----TRGNVRSWHAD-KQANLYAFVRTVQD-
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1bvzA           ATDPDCRRPMIWEEKEQNRGLFEFYKELIRLRHRLASL-----TRGNVRSWHAD-KQANLYAFVRTVQD-
1wzkA           WEEKEQNR----GLFEFYKELIRLRHRLASLTRGNVRSWHAD-------------KQANLYAFVRTVQD-
1ea9C           ----------------------------------------------------------------------
2guyA           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1vfmA           ATDPDCRRPMIWEEKEQNRGLFEFYKELIRLRHRLASL-----TRGNVRSWHAD-KQANLYAFVRTVQD-
1g1yA           ATDPDCRRPMIWEEKEQNRGLFEFYKELIRLRHRLASL-----TRGNVRSWHAD-KQANLYAFVRTVQD-
1vb9A           ----------------------------------------------------------------------
1h3gA           ----------------------------------------------------------------------
3edfA           ----------------------------------------------------------------------
3edeA           ----------------------------------------------------------------------
3eddA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1g5aA           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1rp8A           ----------------------------------------------------------------------
2qpuA           ----------------------------------------------------------------------
2qpsA           ----------------------------------------------------------------------
1mvyA           ----------------------------------------------------------------------
1jgiA           ----------------------------------------------------------------------
1ht6A           ----------------------------------------------------------------------
3bsgA           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
1uokA           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1lwhA           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KQKLIFICNFTPVTYYDYHLGVPDAGSYKEVFNSDNLEFGGSGQVMATEIFSSPQSSHGFEQRITIKIPP
1m7xB           NE-IIVASNFTPVPRHDYRFGINQPGKWREILNTDSMHYHGSNAGNGGTVHSDEIASHGRQHSLSLTLPP
1m7xA           NE-IIVASNFTPVPRHDYRFGINQPGKWREILNTDSMHYHGSNAGNGGTVHSDEIASHGRQHSLSLTLPP
1m7xD           NE-IIVASNFTPVPRHDYRFGINQPGKWREILNTDSMHYHGSNAGNGGTVHSDEIASHGRQHSLSLTLPP
1m7xC           NE-IIVASNFTPVPRHDYRFGINQPGKWREILNTDSMHYHGSNAGNGGTVHSDEIASHGRQHSLSLTLPP
1ehaA           ----------------------------------------------------------------------
1eh9A           ----------------------------------------------------------------------
2e8yA           ----------------------------------------------------------------------
2bhuA           ----------------------------------------------------------------------
2vuyB           ----------------------------------------------------------------------
2vuyA           ----------------------------------------------------------------------
2vr5B           ----------------------------------------------------------------------
2vr5A           ----------------------------------------------------------------------
2vncB           ----------------------------------------------------------------------
2vncA           ----------------------------------------------------------------------
2wanA           ----------------------------------------------------------------------
3fawA           ----------------------------------------------------------------------
2bhzA           ----------------------------------------------------------------------
2bhyA           ----------------------------------------------------------------------
1j0jA           ----------------------------------------------------------------------
1j0hA           ----------------------------------------------------------------------
3faxA           ----------------------------------------------------------------------
1smaA           ----------------------------------------------------------------------
1gviA           ----------------------------------------------------------------------
1wzaA           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
1bf2A           ----------------------------------------------------------------------
2taaA           ----------------------------------------------------------------------
1wzlA           ----------------------------------------------------------------------
2ze0A           ----------------------------------------------------------------------
2wkgA           ----------------------------------------------------------------------
2wcsA           ----------------------------------------------------------------------
2wc7A           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1jf5A           ----------------------------------------------------------------------
1jf6A           ----------------------------------------------------------------------
1wzmA           ----------------------------------------------------------------------
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1bvzA           ----------------------------------------------------------------------
1wzkA           ----------------------------------------------------------------------
1ea9C           ----------------------------------------------------------------------
2guyA           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1vfmA           ----------------------------------------------------------------------
1g1yA           ----------------------------------------------------------------------
1vb9A           ----------------------------------------------------------------------
1h3gA           ----------------------------------------------------------------------
3edfA           ----------------------------------------------------------------------
3edeA           ----------------------------------------------------------------------
3eddA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1g5aA           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1rp8A           ----------------------------------------------------------------------
2qpuA           ----------------------------------------------------------------------
2qpsA           ----------------------------------------------------------------------
1mvyA           ----------------------------------------------------------------------
1jgiA           ----------------------------------------------------------------------
1ht6A           ----------------------------------------------------------------------
3bsgA           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
1uokA           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1lwhA           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           MATLVLxxxx
1m7xB           LATIWL----
1m7xA           LATIWL----
1m7xD           LATIWL----
1m7xC           LATIWL----
1ehaA           ----------
1eh9A           ----------
2e8yA           ----------
2bhuA           ----------
2vuyB           ----------
2vuyA           ----------
2vr5B           ----------
2vr5A           ----------
2vncB           ----------
2vncA           ----------
2wanA           ----------
3fawA           ----------
2bhzA           ----------
2bhyA           ----------
1j0jA           ----------
1j0hA           ----------
3faxA           ----------
1smaA           ----------
1gviA           ----------
1wzaA           ----------
2aaaA           ----------
1bf2A           ----------
2taaA           ----------
1wzlA           ----------
2ze0A           ----------
2wkgA           ----------
2wcsA           ----------
2wc7A           ----------
1d7fA           ----------
1jf5A           ----------
1jf6A           ----------
1wzmA           ----------
1v3kA           ----------
1v3jA           ----------
1pamA           ----------
1bvzA           ----------
1wzkA           ----------
1ea9C           ----------
2guyA           ----------
1qhoA           ----------
1vfmA           ----------
1g1yA           ----------
1vb9A           ----------
1h3gA           ----------
3edfA           ----------
3edeA           ----------
3eddA           ----------
1uksA           ----------
1uktA           ----------
1g5aA           ----------
3dhuB           ----------
1rp8A           ----------
2qpuA           ----------
2qpsA           ----------
1mvyA           ----------
1jgiA           ----------
1ht6A           ----------
3bsgA           ----------
3bshA           ----------
1cgyA           ----------
1tcmA           ----------
1pj9A           ----------
1kckA           ----------
1cxlA           ----------
1cgwA           ----------
1cgvA           ----------
1cdgA           ----------
1dtuA           ----------
1cygA           ----------
1cgxA           ----------
3bmvA           ----------
1a47A           ----------
1uokA           ----------
1pezA           ----------
1lwhA           ----------
1kclA           ----------
1d3cA           ----------
1eo5A           ----------
4cgtA           ----------