[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:ACD30665.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3ismB.bssp"
#ERROR : Can't open dsspfile "3ismA.bssp"
#ERROR : Can't open dsspfile "1zm8A.bssp"
#ERROR : Can't open dsspfile "2o3bA.bssp"
#ERROR : Can't open dsspfile "1qaeA.bssp"
#ERROR : Can't open dsspfile "1g8tA.bssp"
#ERROR : Can't open dsspfile "1ql0A.bssp"

## Summary of PDB Search
:354
    5e-29  37%  3ismB  [x.x.x] CG8862
    5e-29  37%  3ismA  [x.x.x] CG8862
    2e-24  35%  1zm8A  [x.x.x] NUCLEASE
    2e-24  35%  2o3bA  [x.x.x] NUCLEASE
    1e-20  34%  1qaeA  [d.4.1] PROTEIN (EXTRACELLULAR ENDONUCLEASE)
    1e-20  34%  1g8tA  [d.4.1] NUCLEASE SM2 ISOFORM
    7e-20  33%  1ql0A  [d.4.1] NUCLEASE
:354

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ismB           ----------------------------------------------------------------------
3ismA           ----------------------------------------------------------------------
1zm8A           ----------------------------------------------------------------------
2o3bA           ----------------------------------------------------------------------
1qaeA           ----------------------------------------------------------------------
1g8tA           ----------------------------------------------------------------------
1ql0A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLAYGNPSYGVTDGLGQANL
3ismB           ----------------------------------------------------------------------
3ismA           ----------------------------------------------------------------------
1zm8A           ---------------------------------------------------LLLGNPSGATPTKLTPDNY
2o3bA           ---------------------------------------------------LLLGNPSGATPTKLTPDNY
1qaeA           -----------------------------------------------------------------GSSNV
1g8tA           -----------------------------------------------------------------GSSNV
1ql0A           -----------------------------------------------------------------GSSKV


                         +         .         .         .         .         *         .:210
query           YLCRDGYVVGYNYQTKEASWVAFELTKSKVANHLKRDDRFKEDSDVPFVYRATLDDYSRSGYDRGHLASY
3ismB           ------YVLSYDRRNRVPHWVFEHLTAESVAKNDAVDRSFKQDESIHPFFRSQNTDYRRSGYDRGHMAAA
3ismA           ------YVLSYDRRNRVPHWVFEHLTAESVAKNDAVDRSFKQDESIHPFFRSQNTDYRRSGYDRGHMAAA
1zm8A           LMVKNQYALSYNNSKGTANWVAWQLNSSWLGN-AERQDNFRPDKTLPAGWRVTPSMYSGSGYARGHIAPS
2o3bA           LMVKNQYALSYNNSKGTANWVAWQLNSSWLGN-AERQDNFRPDKTLPAGWRVTPSMYSGSGYARGHIAPS
1qaeA           SIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRN--WKTDPALNPADTLAPADYTGANVDRGHQAPL
1g8tA           SIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRN--WKTDPALNPADTLAPADYTGANVDRGHQAPL
1ql0A           SIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRN--WKTDPALNPADTLAPADYTGANVDRGHQAPL


                         .         .         .         +         .         .         .:280
query           ASMDFSKKSADQSFLLSNMSPQKAGLNRQGWERLETDERIWANMYDSIYVYTGPIYKKQKIHKTIGDNKI
3ismB           GNHRLHQKHCDETFYLSNMAPQVGGFNRDAWNTLEAHVRRLTKTYSNVYVCTGPLYKSYVKYEVIGANTV
3ismA           GNHRLHQKHCDETFYLSNMAPQVGGFNRDAWNTLEAHVRRLTKTYSNVYVCTGPLYKSYVKYEVIGANTV
1zm8A           ADRTKTTEDNAATFLMTNMMPQTPDNNRNTWGNLEDYCRELVSQGKELYIVAGPNGSLGKPLK----GKV
2o3bA           ADRTKTTEDNAATFLMTNMMPQTPDNNRNTWGNLEDYCRELVSQGKELYIVAGPNGSLGKPLK----GKV
1qaeA           ASLAGVSDWESLNYL-SNITPQKSDLNQGAWARLEDQERKLIDRADSVYTVTGPLYERD-MGKLPGTQKA
1g8tA           ASLAGVSDWESLNYL-SNITPQKSDLNQGAWARLEDQERKLIDRADSVYTVTGPLYERD-MGKLPGTQKA
1ql0A           ASLAGVSDWESLNYL-SNITPQKSDLNQGAWARLEDQERKLIDRADSVYTVTGPLYERD-MGKLPGTQKA


                         .         *         .         .         .         .         +:350
query           AVPDYFFKIIYVPSKNQAIAFVMPNARVEKTKIANYRVSIKDIEQCTGLHFLTNISNRxxxxxxxxxxxx
3ismB           AVPTHFYKVIVGESADHKLSYVMPNQVISNTPISVFQVPPESVERSAGLLFFDQINRK------------
3ismA           AVPTHFYKVIVGESADHKLSYVMPNQVISNTPISVFQVPPESVERSAGLLFFDQINRK------------
1zm8A           TVPKSTWKIVVVDSPGSGLEGITANTRVIAVNIPNYKVSVDELESLTGYDFLSNVS--------------
2o3bA           TVPKSTWKIVVVDSPGSGLEGITANTRVIAVNIPNYKVSVDELESLTGYDFLSNVS--------------
1qaeA           TIPSAYWKVIFIPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGL---------------------
1g8tA           TIPSAYWKVIFIPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGL---------------------
1ql0A           TIPSAYWKVIFIPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGL---------------------


                         .         .         .         .         *         .         .:420
query           xxxx
3ismB           ----
3ismA           ----
1zm8A           ----
2o3bA           ----
1qaeA           ----
1g8tA           ----
1ql0A           ----