[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:hupB

[Show Plain Result]

#ERROR : Can't open dsspfile "1hueA.bssp"
#ERROR : Can't open dsspfile "1p71B.bssp"
#ERROR : Can't open dsspfile "1p71A.bssp"
#ERROR : Can't open dsspfile "1p51A.bssp"
#ERROR : Can't open dsspfile "1huuA.bssp"
#ERROR : Can't open dsspfile "1huuB.bssp"
#ERROR : Can't open dsspfile "1mulA.bssp"
#ERROR : Can't open dsspfile "1huuC.bssp"
#ERROR : Can't open dsspfile "2o97A.bssp"
#ERROR : Can't open dsspfile "1owfA.bssp"
#ERROR : Can't open dsspfile "2iifA.bssp"
#ERROR : Can't open dsspfile "2iieA.bssp"
#ERROR : Can't open dsspfile "1owfB.bssp"
#ERROR : Can't open dsspfile "1ihfB.bssp"
#ERROR : Can't open dsspfile "2ht0B.bssp"
#ERROR : Can't open dsspfile "3c4iB.bssp"
#ERROR : Can't open dsspfile "3c4iA.bssp"
#ERROR : Can't open dsspfile "1wtuA.bssp"
#ERROR : Can't open dsspfile "1exeA.bssp"
#ERROR : Can't open dsspfile "2o97B.bssp"
#ERROR : Can't open dsspfile "1riyA.bssp"
#ERROR : Can't open dsspfile "1b8zA.bssp"
#ERROR : Can't open dsspfile "2np2A.bssp"

## Summary of PDB Search
:90
    5e-27  54%  1hueA  [a.55.1] HU PROTEIN
    1e-23  52%  1p71B  [a.55.1] DNA-BINDING PROTEIN HU
    1e-23  52%  1p71A  [a.55.1] DNA-BINDING PROTEIN HU
    1e-23  52%  1p51A  [a.55.1] DNA-BINDING PROTEIN HU
    7e-20  52%  1huuA  [a.55.1] PROTEIN HU
    3e-17  53%  1huuB  [a.55.1] PROTEIN HU
    1e-16  51%  1mulA  [a.55.1] DNA BINDING PROTEIN HU-ALPHA
    8e-16  52%  1huuC  [a.55.1] PROTEIN HU
    7e-15  53%  2o97A  [x.x.x] DNA-BINDING PROTEIN HU-ALPHA
    6e-14  34%  1owfA  [a.55.1] INTEGRATION HOST FACTOR ALPHA-SUBUNIT
    6e-14  34%  2iifA  [x.x.x] INTEGRATION HOST FACTOR
    6e-14  34%  2iieA  [x.x.x] INTEGRATION HOST FACTOR
    2e-13  33%  1owfB  [a.55.1] INTEGRATION HOST FACTOR BETA-SUBUNIT
    2e-13  33%  1ihfB  [a.55.1] PROTEIN (INTEGRATION HOST FACTOR (BETA) (IHF))
    2e-13  33%  2ht0B  [x.x.x] INTEGRATION HOST FACTOR BETA-SUBUNIT
    2e-13  31%  3c4iB  [x.x.x] DNA-BINDING PROTEIN HU HOMOLOG
    2e-13  31%  3c4iA  [x.x.x] DNA-BINDING PROTEIN HU HOMOLOG
    3e-11  36%  1wtuA  [a.55.1] TRANSCRIPTION FACTOR 1
    3e-11  36%  1exeA  [a.55.1] TRANSCRIPTION FACTOR 1
    4e-10  51%  2o97B  [x.x.x] DNA-BINDING PROTEIN HU-BETA
    6e-09  39%  1riyA  [a.55.1] HU DNA-BINDING PROTEIN
    4e-07  40%  1b8zA  [a.55.1] PROTEIN (HISTONELIKE PROTEIN HU)
    7e-07  35%  2np2A  [x.x.x] HBB
:90

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNKSELVSAIAKEADVTKEVASNTLDATIAAVTKALKNGDSVTLVGFGTFQVKERSPREGRNPKTGETIK
1hueA           MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLIGFGNFEVRERAARKGRNPQTGEEME
1p71B           MNKGELVDAVAEKASVTKKQADAVLTAALETIIEAVSSGDKVTLVGFGSFESRERKAREGRNPKTNEKME
1p71A           MNKGELVDAVAEKASVTKKQADAVLTAALETIIEAVSSGDKVTLVGFGSFESRERKAREGRNPKTNEKME
1p51A           MNKGELVDAVAEKASVTKKQADAVLTAALETIIEAVSSGDKVTLVGFGSFESRERKAREGRNPKTNEKME
1huuA           MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLIGFGNFEVRERAAR----------ME
1huuB           MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLIGFGNFEVRERA--------------
1mulA           MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAE-------------
1huuC           MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLIGFGNFEVRER---------------
2o97A           MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNH----------------
1owfA           LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
2iifA           LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVELSGFGNFDLRDKNQRPGRNPKTGEDIP
2iieA           LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIP
1owfB           MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIAIRGFGSFSLHYRAPRTGRNPKTGDKVE
1ihfB           MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
2ht0B           MTKSELIERLAQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVE
3c4iB           MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQXXXXXXXXXNPRTGETVK
3c4iA           MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQXXXXXXXXXNPRTGETVK
1wtuA           MNKTELIKAIAQDTELTQVSVSKMLASFEKITTETVAKGDKVQLTGFLNIKPVARQARKGFNPQTQEALE
1exeA           MNKTELIKAIAQDTGLTQVSVSKMLASFEKIITETVAKGDKVQLTGFLNIKPVARQARKGFNPQTQEALE
2o97B           MNKSQLIDKIXXXXXXXXXXXXXXXXXXXS-VTESLKEGDDVALVGFGTFAVKER---------------
1riyA           MNKKELIDRVXXXXXXXXXDVKLILDTILETITEALAKGEKIQIVGFGSFEVRKR---------------
1b8zA           MNKKELIDRVXXXXXXXXXDVKLILDTILETITEALAKGEKVQIVGFGSFEV------------------
2np2A           ------------------------IDAFFEELKSNLCSNNVIEFRSFGTFEVRKRKGRNARNPQTGEYVK


                         .         .         *         .         .         .         .:140
query           IPASKVPSFKASKGLKDAVK
1hueA           IPASKVPAFKPGKALKDAVK
1p71B           IPATRVPAFSAGKLFREKV-
1p71A           IPATRVPAFSAGKLFREKV-
1p51A           IPATRVPAFSAGKLFREKV-
1huuA           IPASKVPAFKPGKALKDAVK
1huuB           --ASKVPAFKPGKALKDAVK
1mulA           -AAANVPAFVSGKALKDAVK
1huuC           ----KVPAFKPGKALKDAVK
2o97A           ----NVPAFVSGKALKDAVK
1owfA           ITARRVVTFRPGQKLKSRVE
2iifA           ITARRVVTFRPGQKLKSRVE
2iieA           ITARRVVTFRPGQKLKSRVE
1owfB           LEGKYVPHFKPGKELRD---
1ihfB           LEGKYVPHFKPGKELRD---
2ht0B           LEGKYVPHFKPGKELRD---
3c4iB           VKPTSVPAFRPGAQFKAVV-
3c4iA           VKPTSVPAFRPGAQFKAVV-
1wtuA           IAPSVGVSVKPGESLKKAAE
1exeA           IAPSVGVSVKPGESLKKAAE
2o97B           ---AKVPSFRAGKALKDAV-
1riyA           ----KVPKFKPGKALKEKVK
1b8zA           -----VPKFKPGKALKEKVK
2np2A           VLDHHVAYFRPGKDLKERV-