[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:galU

[Show Plain Result]

#ERROR : Can't open dsspfile "2ux8G.bssp"
#ERROR : Can't open dsspfile "2ux8F.bssp"
#ERROR : Can't open dsspfile "2ux8D.bssp"
#ERROR : Can't open dsspfile "2ux8C.bssp"
#ERROR : Can't open dsspfile "2ux8E.bssp"
#ERROR : Can't open dsspfile "2ux8B.bssp"
#ERROR : Can't open dsspfile "2e3dC.bssp"
#ERROR : Can't open dsspfile "2e3dA.bssp"
#ERROR : Can't open dsspfile "2e3dB.bssp"
#ERROR : Can't open dsspfile "2e3dD.bssp"
#ERROR : Can't open dsspfile "2ux8A.bssp"
#ERROR : Can't open dsspfile "2ux8H.bssp"
#ERROR : Can't open dsspfile "2pa4D.bssp"
#ERROR : Can't open dsspfile "2pa4B.bssp"
#ERROR : Can't open dsspfile "2pa4A.bssp"
#ERROR : Can't open dsspfile "2ggoA.bssp"
#ERROR : Can't open dsspfile "1h5sB.bssp"
#ERROR : Can't open dsspfile "1h5sD.bssp"
#ERROR : Can't open dsspfile "1h5rB.bssp"
#ERROR : Can't open dsspfile "1h5rA.bssp"
#ERROR : Can't open dsspfile "1iimA.bssp"
#ERROR : Can't open dsspfile "1h5sA.bssp"
#ERROR : Can't open dsspfile "1mp4A.bssp"
#ERROR : Can't open dsspfile "1mp5A.bssp"
#ERROR : Can't open dsspfile "1mp3A.bssp"
#ERROR : Can't open dsspfile "1fxoB.bssp"
#ERROR : Can't open dsspfile "1fxoA.bssp"
#ERROR : Can't open dsspfile "1lvwB.bssp"
#ERROR : Can't open dsspfile "1lvwA.bssp"
#ERROR : Can't open dsspfile "1lvwD.bssp"
#ERROR : Can't open dsspfile "1lvwC.bssp"
#ERROR : Can't open dsspfile "1g23A.bssp"
#ERROR : Can't open dsspfile "1mc3A.bssp"
#ERROR : Can't open dsspfile "3fwwA.bssp"
#ERROR : Can't open dsspfile "1jylA.bssp"
#ERROR : Can't open dsspfile "1jykA.bssp"
#ERROR : Can't open dsspfile "2oi6B.bssp"
#ERROR : Can't open dsspfile "2oi6A.bssp"
#ERROR : Can't open dsspfile "1hv9B.bssp"
#ERROR : Can't open dsspfile "1hv9A.bssp"
#ERROR : Can't open dsspfile "1fxjA.bssp"
#ERROR : Can't open dsspfile "1fwyB.bssp"
#ERROR : Can't open dsspfile "1fwyA.bssp"
#ERROR : Can't open dsspfile "1hm9A.bssp"
#ERROR : Can't open dsspfile "3hl3A.bssp"
#ERROR : Can't open dsspfile "1g97A.bssp"
#ERROR : Can't open dsspfile "2v0jA.bssp"
#ERROR : Can't open dsspfile "2v0hA.bssp"
#ERROR : Can't open dsspfile "1g95A.bssp"
#ERROR : Can't open dsspfile "1yp4C.bssp"
#ERROR : Can't open dsspfile "1yp3C.bssp"
#ERROR : Can't open dsspfile "1hm0A.bssp"
#ERROR : Can't open dsspfile "1yp2C.bssp"
#ERROR : Can't open dsspfile "1yp3B.bssp"
#ERROR : Can't open dsspfile "2qh5B.bssp"
#ERROR : Can't open dsspfile "2qh5A.bssp"

## Summary of PDB Search
:287
    3e-69  51%  2ux8G  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    1e-63  50%  2ux8F  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    2e-63  50%  2ux8D  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    2e-63  50%  2ux8C  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    3e-63  51%  2ux8E  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    1e-62  50%  2ux8B  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    1e-61  49%  2e3dC  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    3e-60  50%  2e3dA  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    9e-59  50%  2e3dB  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    1e-57  49%  2e3dD  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    2e-53  51%  2ux8A  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    1e-52  53%  2ux8H  [x.x.x] GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    6e-42  40%  2pa4D  [x.x.x] UTP-GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    7e-42  38%  2pa4B  [x.x.x] UTP-GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    7e-42  38%  2pa4A  [x.x.x] UTP-GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    1e-20  38%  2ggoA  [x.x.x] 401AA LONG HYPOTHETICAL GLUCOSE-1-PHOSPHATE
    8e-20  30%  1h5sB  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    1e-19  29%  1h5sD  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    3e-19  29%  1h5rB  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    3e-19  29%  1h5rA  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    7e-19  29%  1iimA  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    7e-19  29%  1h5sA  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    9e-19  29%  1mp4A  [c.68.1] W224H VARIANT OF S. ENTERICA RMLA BOUND TO UDP-
    3e-18  29%  1mp5A  [c.68.1] Y177F VARIANT OF S. ENTERICA RMLA BOUND TO UDP-
    3e-18  29%  1mp3A  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    1e-16  32%  1fxoB  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    1e-16  32%  1fxoA  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    5e-14  26%  1lvwB  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    5e-14  26%  1lvwA  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    2e-13  26%  1lvwD  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    2e-13  26%  1lvwC  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    5e-13  32%  1g23A  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    1e-11  30%  1mc3A  [c.68.1] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    4e-08  28%  3fwwA  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    5e-08  38%  1jylA  [c.68.1] CTP:PHOSPHOCHOLINE CYTIDYLYTRANSFERASE
    5e-08  38%  1jykA  [c.68.1] CTP:PHOSPHOCHOLINE CYTIDYLYTRANSFERASE
    9e-08  28%  2oi6B  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    9e-08  28%  2oi6A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    9e-08  28%  1hv9B  [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
    9e-08  28%  1hv9A  [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
    9e-08  28%  1fxjA  [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
    9e-08  28%  1fwyB  [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
    9e-08  28%  1fwyA  [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE
    2e-07  27%  1hm9A  [c.68.1 - b.81.1] UDP-N-ACETYLGLUCOSAMINE-1-PHOSPHATE
    2e-07  26%  3hl3A  [x.x.x] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    2e-07  27%  1g97A  [c.68.1 - b.81.1] N-ACETYLGLUCOSAMINE-1-PHOSPHATE
    3e-07  29%  2v0jA  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    3e-07  29%  2v0hA  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    1e-06  27%  1g95A  [c.68.1 - b.81.1] N-ACETYLGLUCOSAMINE-1-PHOSPHATE
    4e-05  28%  1yp4C  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    4e-05  28%  1yp3C  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    4e-05  26%  1hm0A  [c.68.1 - b.81.1] N-ACETYLGLUCOSAMINE 1-PHOSPHATE
    7e-05  27%  1yp2C  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    2e-04  28%  1yp3B  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    4e-04  26%  2qh5B  [x.x.x] MANNOSE-6-PHOSPHATE ISOMERASE
    4e-04  26%  2qh5A  [x.x.x] MANNOSE-6-PHOSPHATE ISOMERASE
:287

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKIRKAVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAIEAGCKEIIFVTSSNKKSLEDHFDRN
2ux8G           --LRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALEDHFDIA
2ux8F           --LRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALEDHFDIA
2ux8D           --LRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALEDHFDIA
2ux8C           --LRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALEDHFDIA
2ux8E           --LRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALEDHFDIA
2ux8B           --LRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALEDHFDIA
2e3dC           -KVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTS
2e3dA           -KVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTS
2e3dB           -KVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTS
2e3dD           -KVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTS
2ux8A           --LRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALEDHFDIA
2ux8H           --LRKAVFPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALEDHFDIA
2pa4D           --VKTVVVPAAGLGTRFLPATKTVPKELLPVVDTPXXXXXXXXXXXXXXTRLAIITAPNKAGVLAHFERS
2pa4B           --VKTVVVPAAGLGTRFLPATKTVPKELLPVVDTPXXXXXXXXXXXXXXTRLAIITAPNKAGVLAHFERS
2pa4A           --VKTVVVPAAGLGTRFLPATKTVPKELLPVVDTPXXXXXXXXXXXXXXTRLAIITAPNKAGVLAHFERS
2ggoA           ----KAFILAAGSGERLEPITHTRPKAFVPILSKPLIEYQIEYLRKCGIRDITVIVSSKNK---------
1h5sB           MKMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQQQLLGDGSQWG
1h5sD           -KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQQQLLGDGSQWG
1h5rB           -KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQQQLLGDGSQWG
1h5rA           -KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQQQLLGDGSQWG
1iimA           MKTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQQQLLGDGSQWG
1h5sA           -KMRKGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQQQLLGDGSQWG
1mp4A           MKTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQQQLLGDGSQWG
1mp5A           MKTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQQQLLGDGSQWG
1mp3A           MKTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQQQLLGDGSQWG
1fxoB           ---RKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQQQLLGDGSNWG
1fxoA           ---RKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQQQLLGDGSNWG
1lvwB           ----KGIVLAGGSGTRLYPITRAVSKQLLPIYDKPMIYYPLSVLMLAGIRDILIISTPRDLPL-------
1lvwA           ----KGIVLAGGSGTRLYPITRAVSKQLLPIYDKPMIYYPLSVLMLAGIRDILIISTPRDLPL-------
1lvwD           ---------VLAGGTRLYPITRAVSKQLLPIYDKPMIYYPLSVLMLAGIRDILIISTPRDLPL-------
1lvwC           ---------VLAGGTRLYPITRAVSKQLLPIYDKPMIYYPLSVLMLAGIRDILIISTPRDLPL-------
1g23A           ---RKGIILAGGSGTRLHPATLAISKQLLPVYDKPI--YYPLSTLLAGIREILIISTPQQQLLGDGSNWG
1mc3A           ----KGIILAGGSGTRLHPITRGVSKQLLPIYDKPI--YYPLSVLLAGIREILIITTPEDKGLGDGSEFG
3fwwA           ------VILAAGKGTRMY---SDLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYGHGG----------
1jylA           ----KAIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIVGYLKEQFD------
1jykA           ----KAIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIVGYLKEQFD------
2oi6B           ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
2oi6A           ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
1hv9B           ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
1hv9A           ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
1fxjA           ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
1fwyB           ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
1fwyA           ------VILAAGKGTRMY---SDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGG----------
1hm9A           ----------------------------------------------------------------------
3hl3A           ----KGIILAGGTGSRLYPITKVTNKHLLPVGRYPMIYHAVYKLKQCDITDIMIITG-------------
1g97A           ----------------------------------------------------------------------
2v0jA           -KALSAVILAAGKGTRMY---SDLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYGHGGDLMRTHL-AN
2v0hA           -KALSAVILAAGKGTRMY---SDLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYGHGGDLMRTHL-AN
1g95A           ----------------------------------------------------------------------
1yp4C           -----------GAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRA
1yp3C           -----------GAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRA
1hm0A           ----------------------------------------------------------------------
1yp2C           ----RSVLGIILGGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRA
1yp3B           -----------GAGTRLYPLTKKRAKPAVPLANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSR-
2qh5B           ----------------------------------------------------------HKSLFELSFKRN
2qh5A           ----------------------------------------------------------HKSLFELSFKRN


                         .         .         *         .         .         .         .:140
query           FELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQPEALGLGHAVLCAKPLVGIEDFAVILPDDLIYNHDC
2ux8G           YELEATMAARGK--SLDVLDGTRLKPGNIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQ--
2ux8F           YELEATMAARGK--SLDVLDGTRLKPGNIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQ--
2ux8D           YELEATMAARGK--SLDVLDGTRLKPGNIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQ--
2ux8C           YELEATMAARGK--SLDVLDGTRLKPGNIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQ--
2ux8E           YELEATMAARGK--SLDVLDGTRLKPGNIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQ--
2ux8B           YELEATMAARGK--SLDVLDGTRLKPGNIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQ--
2e3dC           FELEAMLER----QLLDEVQSICPPHVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDVILYESDL
2e3dA           FELEAMLER----QLLDEVQSICPPHVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDVILYESDL
2e3dB           FELEAMLEKRQ---LLDEVQSICPPHVTIMQVRQGK--GLGHAVLCAHPVVGDEPVAVILPDVILYESDL
2e3dD           FELEAML----KRQLLDEVQSICPPHVTIMQVRQGK--GLGHAVLCAHPVVGDEPVAVILPDVILYESDL
2ux8A           YELEATMAARGK--SLDVLDGTRLKPGNIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQ--
2ux8H           YELEATMAARGKS--LDVLDGTRLKPGNIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQP-
2pa4D           SELEETLMERDQVEIIRRAADLI-KAVP---VTQDKPLGLGHAVGLAESVLDDDEVAVMLPDDLVLP---
2pa4B           SELEETLMERGKTDQVEIIRRAADL-IKAVPVTQDKPLGLGHAVGLAESVLDDDEVAVMLPDDLVLP---
2pa4A           SELEETLMERGKTDQVEIIRRAADL-IKAVPVTQDKPLGLGHAVGLAESVLDDDEVAVMLPDDLVLP---
2ggoA           ---EY-FEKKLKE-----ISIVTQKD---------DIKGTGAAILSAK----FNDEALIIYGDLFFSNEC
1h5sB           LNLQYKV--------------------------QPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHD-
1h5sD           LNLQYKV--------------------------QPSPDGLAQAFIIGEEFIGADDCALVLGDNIFYGHD-
1h5rB           LNLQYKV--------------------------QPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHD-
1h5rA           LNLQYKV--------------------------QPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHD-
1iimA           LNLQYKV--------------------------QPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYGHD-
1h5sA           LNLQYKV--------------------------QPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHD-
1mp4A           LNLQYKV--------------------------QPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYGHD-
1mp5A           LNLQYKV--------------------------QPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYGHD-
1mp3A           LNLQYKV--------------------------QPSPDGTAQAFIIGEEFIGHDDCALVLGDNIFYGHD-
1fxoB           LDLQYAV--------------------------QPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDL
1fxoA           LDLQYAV--------------------------QPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDL
1lvwB           --------------YRDLLGDGSQFGVRFSYRVQEEPRGIADAFIVGKDFIGDSKVALVLGDNVFYGHRF
1lvwA           --------------YRDLLGDGSQFGVRFSYRVQEEPRGIADAFIVGKDFIGDSKVALVLGDNVFYGHRF
1lvwD           --------------YRDLLGDGSQFGVRFSYRVQEEPRGIADAFIVGKDFIGDSKVALVLGDNVFYGHRF
1lvwC           --------------YRDLLGDGSQFGVRFSYRVQEEPRGIADAFIVGKDFIGDSKVALVLGDNVFYGHRF
1g23A           LDLQYAV--------------------------QPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDL
1mc3A           IQLEYA--------------------------EQPSPDGLAQAFIIGETFLNGEPSCLVLGDNIFFGQGF
3fwwA           ----------------ELLKKTLA-DPSLNWVLQAEQLGTGHAMQQAAPFADDEDILMLYGDVPLISVD-
1jylA           ----------------------------------------------------------------------
1jykA           ----------------------------------------------------------------------
2oi6B           ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
2oi6A           ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
1hv9B           ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
1hv9A           ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
1fxjA           ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
1fwyB           ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
1fwyA           ----------------DLLKQAL-KDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPL---I
1hm9A           ------------------------------FVTQSEQLGTGHAVMMTEPILGLSGHTLVIAGDT----PL
3hl3A           --------KEHMGDVVSFLGSGQEFGVSFTYRVQDKAGGIAQALGLCEDFVGNDRMVVILGDN-IFSDD-
1g97A           ------------------------------FVTQSEQLGTGHAVMMTEPILGLSGHTLVIAGDT----PL
2v0jA           EQVNW--------------------------VLQTEQLGTAHAVQQAAPFFKDNENIVVL------YGDA
2v0hA           EQVNW--------------------------VLQTEQLGTAHAVQQAAPFFKDNENIVVL------YGDA
1g95A           ------------------------------FVTQSEQLGTGHAVMMTEPILGLSGHTLVIAGDT----PL
1yp4C           YASEGFVEV--------LAAQQSPENPDWFAVRQYLWLFEEHTVL----------EYLILAGDHLYRMD-
1yp3C           YASEGFVEV--------LAAQQSPENPDWFAVRQYLWLFEEHTVL----------EYLILAGDHLYRMD-
1hm0A           ------------------------------FVTQSEQLGTGHAVMMTEPILGLSGHTLVIAGDLITGE--
1yp2C           YASEGFVEV--------LAAQQSPENPDWFAVRQYLWLFEEHTVL----------EYLILAGDHLYRMD-
1yp3B           ---AYASNNEGFVEVLAAQQS-------------PENQGTADAV--RQYLWLFEEHTVILAGDHLYRMD-
2qh5B           ASLVDETNEKHYFLALEEIKNEI-KNKSVGFLLESLSKNTANAIALSALMSDKEDLLIVTPSDLIKDLQA
2qh5A           ASLVDETNEKHYFLALEEIKNEI-KNKSVGFLLESLSKNTANAIALSALMSDKEDLLIVTPSDLIKDLQA


                         +         .         .         .         .         *         .:210
query           GTGTLKQMVKAVEGTDIRGCIATQQVKREKTNSYGIVAKDNDNLIKAIVEKPAPEKAPSTNAVVGRYLLP
2ux8G           -PGCLKQMVDAYNKVG-GNLICAEEVPDDQTHRYGIITPGTQDEVKGLVEKPAPGTAPSNLSVIGRYILQ
2ux8F           -PGCLKQMVDAYNKVG-GNLICAEEVPDDQTHRYGIITPGTQDEVKGLVEKPAPGTAPSNLSVIGRYILQ
2ux8D           -PGCLKQMVDAYNKVG-GNLICAEEVPDDQTHRYGIITPGTQDEVKGLVEKPAPGTAPSNLSVIGRYILQ
2ux8C           -PGCLKQMVDAYNKVG-GNLICAEEVPDDQTHRYGIITPGTQDEVKGLVEKPAPGTAPSNLSVIGRYILQ
2ux8E           -PGCLKQMVDAYNKVG-GNLICAEEVPDDQTHRYGIITPGTQDEVKGLVEKPAPGTAPSNLSVIGRYILQ
2ux8B           -PGCLKQMVDAYNKVG-GNLICAEEVPDDQTHRYGIITPGTQDEVKGLVEKPAPGTAPSNLSVIGRYILQ
2e3dC           SQDNLAEMIRRFDETG-HSQIMVEPV--ADVTAYGVVDCKGVELVPMVGVVPKADVAPSNLAIVGRYVLS
2e3dA           SQDNLAEMIRRFDETG-HSQIMVEPV--ADVTAYGVVAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLS
2e3dB           SQDNLAEMIRRFDETG-HSQIMVEPV--ADVTAYGVVAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLS
2e3dD           SQDNLAEMIRRFDETG-HSQIMVEPV--ADVTAYGVVDCKGVELAPGESVPMVGVVEPSNLAIVGRYVLS
2ux8A           -PGCLKQMVDAYN-------------------------KVGGNLICAEIITPGTQDGVLTESVIGRYILQ
2ux8H           --GCLKQMVDAYN-------------------------KVGGNLICA-------ELTEVKGLVIGRYILQ
2pa4D           -TGVMERMVRAEFGGSV---LCAVEVSEADVSKYGIFTKDSDKKVKGMVEKPAIEDAPSRLAATGRYLLD
2pa4B           -TGVMERMVRAEFGGSV---LCAVEVSEADVSKYGIFTKDSDKKVKGMVEKPAIEDAPSRLAATGRYLLD
2pa4A           -TGVMERMVRAEFGGSV---LCAVEVSEADVSKYGIFTKDSDKKVKGMVEKPAIEDAPSRLAATGRYLLD
2ggoA           NIITLKE--NAIIG-----------VKVSNPKDYGVLVLDNQNNLSKIIEK--PEIPPSNLINAGIYKLN
1h5sB           ----LPKLMEAAVNKESGATVFAYHV--NDPERYGVVEFDKNGTAISLEEKPLEPK--SNYAVTGLYFYD
1h5sD           ----LPKLMEAAVNKESGATVFAYHV--NDPERYGVVEFDKNGTAISLEEKPLEPK--SNYAVTGLYFYD
1h5rB           ----LPKLMEAAVNKESGATVFAYHV--NDPERYGVVEFDKNGTAISLEEKPLEPK--SNYAVTGLYFYD
1h5rA           ----LPKLMEAAVNKESGATVFAYHV--NDPERYGVVEFDKNGTAISLEEKPLEPK--SNYAVTGLYFYD
1iimA           ----LPKLMEAAVNKESGATVFAYHV--NDPERYGVVEFDQKGTAVSLEEKPLQPK--SNYAVTGLYFYD
1h5sA           ----LPKLMEAAVNKESGATVFAYHV--NDPERYGVVEFDKNGTAISLEEKPLEPK--SNYAVTGLYFYD
1mp4A           ----LPKLMEAAVNKESGATVFAYHV--NDPERYGVVEFDQAGTAVSLEEKPLQPK--SNYAVTGLYFYD
1mp5A           ----LPKLMEAAVNKESGATVFAYHV--NDPERYGVVEFDQAGTAVSLEEKPLQPK--SNYAVTGLFFYD
1mp3A           ----LPKLMEAAVNKESGATVFAYHV--NDPERYGVVEFDQAGTAVSLEEKPLQPK--SNYAVTGLYFYD
1fxoB           GSASQRQTGASV--------FAYHVLDPER---YGVVEFDQGGKAISLEEKPLEPK--SNYAVTGLYFYD
1fxoA           GSASQRQTGASV--------FAYHVLDPER---YGVVEFDQGGKAISLEEKPLEPK--SNYAVTGLYFYD
1lvwB           -SEILRRAASLEDGAVIFGYYV------RDPRPFGVVEFDSEGRVISIEEKPSRPK--SNYVVPGLYFYD
1lvwA           -SEILRRAASLEDGAVIFGYYV------RDPRPFGVVEFDSEGRVISIEEKPSRPK--SNYVVPGLYFYD
1lvwD           -SEILRRAASLEDGAVIFGYYV------RDPRPFGVVEFDSEGRVISIEEKPSRPK--SNYVVPGLYFYD
1lvwC           -SEILRRAASLEDGAVIFGYYV------RDPRPFGVVEFDSEGRVISIEEKPSRPK--SNYVVPGLYFYD
1g23A           GSASQRQTGASV--------FAYHVLDPER---YGVVEFDQGGKAISLEEKPLEPK--SNYAVTGLYFYD
1mc3A           -SPKLRHVAARTEGATVFG----YQVDPER---FGVVEFDDNFRAISLEEKP---KQPKSNAVTGLYFYD
3fwwA           ---TLQRLLAAKP----EGGIGLLTVKLDNPSGYGRIVRENGDVVGIVEHKDASDAQREINEINTGILVA
1jylA           ----------------------------------------------------------------------
1jykA           ----------------------------------------------------------------------
2oi6B           SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
2oi6A           SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
1hv9B           SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
1hv9A           SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
1fxjA           SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
1fwyB           SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
1fwyA           SVETLQRLRDAKP----QGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIA
1hm9A           ITG---ESLKNLIDFHINHKNVATILTAETDNPFGIVRNDNAEVLRIVEQKDATDFEKQIKEITGTYVFD
3hl3A           ----IRPYVEEFTNQKEGAKVLLQSV--DDPERFGVANIQNR---XXXXXXXXXXXXXSSYAVTGIYLYD
1g97A           ITG---ESLKNLIDFHINHKNVATILTAETDNPFGIVRNDNAEVLRIVEQKDATDFEKQIKEITGTYVFD
2v0jA           PLITKETLEKLIEAKPENG-IALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANAEQLNIKEVTGVMVSD
2v0hA           PLITKETLEKLIEAKPENG-IALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANAEQLNIKEVTGVMVSD
1g95A           ITG---ESLKNLIDFHINHKNVATILTAETDNPFGIVRNDNAEVLRIVEQKDATDFEKQIKEITGTYVFD
1yp4C           ----YEKFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEFAEKPQGEQ--------------
1yp3C           ----YEKFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEFAEKPQGEQ--------------
1hm0A           ---SLKNLIDFHINHKNVATILTAET--DNPFGYGRIV-----VLRIVEQKDATDFEKQIKEITGTYVFD
1yp2C           ----YEKFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEFAEKPQGEQ--------------
1yp3B           ----YEKFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEFAEKPQGEQ--------------
2qh5B           YENAIKKAIDLAQ----KGFLVTFGVSIDKPNTFGYIESPNGLDVKRFIEKPSLDKA-------------
2qh5A           YENAIKKAIDLAQ----KGFLVTFGVSIDKPNTFGYIESPNGLDVKRFIEKPSLDKA-------------


                         .         .         .         +         .         .         .:280
query           NKIFRCLESTSEGAGGEIQLTDAIAKLLDQDEKILSYEFKGTRYDCGSKLGFLIANYEIALQHQELGHKF
2ux8G           PEVMRILENQGKGAGGEIQLTDAMQRMIG-DQPFHGVTFQGTRYDCGDKAGFIQANLAVALSRPDL----
2ux8F           PEVMRILENQGK------QLTDAMQRMIG-DQPFHGVTFQGTRYDCGDKAGFIQANLAVALSRPDL----
2ux8D           PEVMRILENQG-------QLTDAMQRMIG-DQPFHGVTFQGTRYDCGDKAGFIQANLAVALSRPDL----
2ux8C           PEVMRILENQG-------QLTDAMQRMIG-DQPFHGVTFQGTRYDCGDKAGFIQANLAVALSRPDL----
2ux8E           PEVMRILENQ--------QLTDAMQRMIG-DQPFHGVTFQGTRYDCGDKAGFIQANLAVALSRPDL----
2ux8B           PEVMRILENQG--------LTDAMQRMIG-DQPFHGVTFQGTRYDCGDKAGFIQANLAVALSRPDL----
2e3dC           ADIWPLLAKTPPGAGDEIQLTDAIDMLIEK-ETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEF
2e3dA           ADIWPLLAKTPP----EIQLTDAIDMLIEK-ETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEF
2e3dB           ADIWPLLAKT--------QLTDAIDMLIEK-ETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEF
2e3dD           ADIWPLLAKT--GAGDEIQLTDAIDMLIEK-ETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEF
2ux8A           PEVMRILENQG--------LTDAMQRMIG-DQPFHGVTFQGTRYDCGDKAGFIQANLAVALSRPDL----
2ux8H           PEVMRILEN---------QLTDAMQRMIG-DQPFHGVTFQGTRYDCGDKAGFIQANLAVALSRPDL----
2pa4D           RKIFDALRRITPGAGGELQLTDAIDLLIDEGHPVHIVIHQGKRHDLGNPGGYIPACVDFGLSHPVYGAQL
2pa4B           RKIFDALRRITPGAGGELQLTDAIDLLIDEGHPVHIVIHQGKRHDLGNPGGYIPACVDFGLSHPVYGAQL
2pa4A           RKIFDALRRITPGAGGELQLTDAIDLLIDEGHPVHIVIHQGKRHDLGNPGGYIPACVDFGLSHPVYGAQL
2ggoA           SDIFTYLDKISISERGELELTDAI-NLMAKDHRVKVIEYEGYWMDIGKPWNIIDVN--------------
1h5sB           NDVVQMAKNLKPSARGELEITDINRIYLEQGR--LSVALMGRGYDTGTHQSLIEASNFIATIEERQGLK-
1h5sD           NDVVQMAKNLKPSARGELEITDINRIYLEQGR--LSVALMGRGYDTGTHQSLIEASNFIATIEERQGLK-
1h5rB           NDVVQMAKNLKPSARGELEITDINRIYLEQGR--LSVALMGRGYDTGTHQSLIEASNFIATIEERQGLK-
1h5rA           NDVVQMAKNLKPSARGELEITDINRIYLEQGR--LSVAMMGRGYDTGTHQSLIEASNFIATIEERQGLK-
1iimA           NSVVEMAKNLKPSARGELEITDINRIYMEQGR--LSVAMMGRGYDTGTHQSLIEASNFIATIEERQGLK-
1h5sA           NDVVLMAKNLKPSARGELEITDINRIYLEQGR--LSVALMGRGYDTGTHQSLIEASNFIATIEERQGLK-
1mp4A           NSVVEMAKNLKPSARGELEITDINRIYMEQGR--LSVAMMGRGYDTGTHQSLIEASNFIATIEERQGLK-
1mp5A           NSVVEMAKNLKPSARGELEITDINRIYMEQGR--LSVAMMGRGYDTGTHQSLIEASNFIATIEERQGLK-
1mp3A           NSVVEMAKNLKPSARGELEITDINRIYMEQGR--LSVAMMGRGYDTGTHQSLIEASNFIATIEERQGLK-
1fxoB           QQVVDIARDLKPSPRGELEITDVNRAYLERGQ--LSVEIMGRGYDTGTHDSLLEAGQFIATLENRQGLK-
1fxoA           QQVVDIARDLKPSPRGELEITDVNRAYLERGQ--LSVEIMGRGYDTGTHDSLLEAGQFIATLENRQGLK-
1lvwB           NQVVEIARRIEPSDRGELEITSVNEEYLRMGKLRVELMGRGMAWDTGTHDGLLEAS--------------
1lvwA           NQVVEIARRIEPSDRGELEITSVNEEYLRMGKLRVELMGRGMAWDTGTHDGLLEAS--------------
1lvwD           NQVVEIARRIEPSDRGELEITSVNEEYLRMGKLRVELMGRGMAWDTGTHDGLLEAS--------------
1lvwC           NQVVEIARRIEPSDRGELEITSVNEEYLRMGKLRVELMGRGMAWDTGTHDGLLEAS--------------
1g23A           QQVVDIARDLKPSPRGELEITDVNRAYLERGQ--LSVEI-GRGYDTGTHDSLLEAGQFIATLENRQGLK-
1mc3A           SKVVEYAKQVKPSERGELEIT-------------------------------------------------
3fwwA           NRDLKRWLSLLDNNQGEFYITDIIALAHADGKKI------------------------------------
1jylA           ----------------------------------------------------------------------
1jykA           ----------------------------------------------------------------------
2oi6B           NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
2oi6A           NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
1hv9B           NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
1hv9A           NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
1fxjA           NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
1fwyB           NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
1fwyA           NDMKRWLKLTNNNAQGEYYITDIIALAYQEGREIVA----------------------------------
1hm9A           NRLFEALKNNTNNAQGEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAE-SVMRRRINHK-
3hl3A           SKVFSYIKELKPSARGELEITDINNWYLKRG--VLTYEMSGWWTDAGTHVSLQRAN--------------
1g97A           NRLFEALKNNTNNAQGEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAE-SVMRRRINHK-
2v0jA           GASFKLARVGNNNAQGEYYLTDLIA-LANQD---------------------------------------
2v0hA           GASFKLARVGNNNAQGEYYLTDLIA-LANQD---------------------------------------
1g95A           NRLFEALKNI-----GEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAE-SVMRRRINHK-
1yp4C           ----------------------------------------------------------------------
1yp3C           ----------------------------------------------------------------------
1hm0A           NRLFEALKNNTNNAQGEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAE-SVMRRRINHK-
1yp2C           ----------------------------------------------------------------------
1yp3B           ----------------------------------------------------------------------
2qh5B           ----------------------------------------------------------------------
2qh5A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KEYLQxx
2ux8G           -------
2ux8F           -------
2ux8D           -------
2ux8C           -------
2ux8E           -------
2ux8B           -------
2e3dC           KAWLE--
2e3dA           KAWLE--
2e3dB           KAWLE--
2e3dD           KAWLE--
2ux8A           -------
2ux8H           -------
2pa4D           KDAIK--
2pa4B           KDAIK--
2pa4A           KDAIK--
2ggoA           -------
1h5sB           -------
1h5sD           -------
1h5rB           -------
1h5rA           -------
1iimA           -------
1h5sA           -------
1mp4A           -------
1mp5A           -------
1mp3A           -------
1fxoB           -------
1fxoA           -------
1lvwB           -------
1lvwA           -------
1lvwD           -------
1lvwC           -------
1g23A           -------
1mc3A           -------
3fwwA           -------
1jylA           -------
1jykA           -------
2oi6B           -------
2oi6A           -------
1hv9B           -------
1hv9A           -------
1fxjA           -------
1fwyB           -------
1fwyA           -------
1hm9A           -------
3hl3A           -------
1g97A           -------
2v0jA           -------
2v0hA           -------
1g95A           -------
1yp4C           -------
1yp3C           -------
1hm0A           -------
1yp2C           -------
1yp3B           -------
2qh5B           -------
2qh5A           -------