[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:ACD30777.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1te5A.bssp"
#ERROR : Can't open dsspfile "1xffB.bssp"
#ERROR : Can't open dsspfile "1xffA.bssp"
#ERROR : Can't open dsspfile "2j6hA.bssp"
#ERROR : Can't open dsspfile "2bplA.bssp"

## Summary of PDB Search
:268
    7e-07  31%  1te5A  [d.153.1] CONSERVED HYPOTHETICAL PROTEIN
    2e-04  34%  1xffB  [d.153.1] GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE
    2e-04  34%  1xffA  [d.153.1] GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE
    2e-04  34%  2j6hA  [x.x.x] GLUCOSAMINE-FRUCTOSE-6-PHOSPHATE
    2e-04  34%  2bplA  [d.153.1 - c.80.1 (1jxaA)] GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE
:268

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGAVPVNGDGFGVGWYTSLHKEPGVYKDPLPAWNNQN
1te5A           ----------------------------------GGTGPHRDGWGIAFYEG--RGVRLFQDPLASVDSEV
1xffB           ----------------------------------------------------------------------
1xffA           ----------------------------------------------------------------------
2j6hA           ----------------------------------------------------------------------
2bplA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LISLAKHIKSRNFMAHVRASTIAPTSRVNCHPFTFKNHLFMHNGSIAGFDDIRQEIEQLVKPQYFKARFG
1te5A           ARLVQRFIKSETVIGHIRQANVGKVGLSNTHPFIGRYWTFAHNGQLADFQP---------KPGFYRP-VG
1xffB           -------------IAHTRWATHGEPSEVNAHPHVSEHIVVVHNGIIENHEPLREELK-------------
1xffA           -------------IAHTRWATHGEPSEVNAHPHVSEHIVVVHNGIIENHEPLREELK-------------
2j6hA           -------------IAHTRWATHGEPSEVNAHPHVSEHIVVVHNGIIENHEPLREELK-------------
2bplA           -------------IAHTRWATHGEPSEVNAHPHVSEHIVVVHNGIIENHEPLREELK-------------


                         +         .         .         .         .         *         .:210
query           STDSEAIFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1te5A           ETDSEAAF--------------------------------------------------------------
1xffB           ----------------------------------------------------------------------
1xffA           ----------------------------------------------------------------------
2j6hA           ----------------------------------------------------------------------
2bplA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1te5A           ----------------------------------------------------------
1xffB           ----------------------------------------------------------
1xffA           ----------------------------------------------------------
2j6hA           ----------------------------------------------------------
2bplA           ----------------------------------------------------------