[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:ACD30798.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3eo3B.bssp"
#ERROR : Can't open dsspfile "3eo3A.bssp"
#ERROR : Can't open dsspfile "3eo3C.bssp"
#ERROR : Can't open dsspfile "2hoeA.bssp"
#ERROR : Can't open dsspfile "2qm1B.bssp"
#ERROR : Can't open dsspfile "2qm1A.bssp"
#ERROR : Can't open dsspfile "1z05A.bssp"
#ERROR : Can't open dsspfile "2ap1A.bssp"
#ERROR : Can't open dsspfile "3bp8A.bssp"
#ERROR : Can't open dsspfile "3bp8B.bssp"
#ERROR : Can't open dsspfile "1xc3A.bssp"
#ERROR : Can't open dsspfile "1woqA.bssp"

## Summary of PDB Search
:268
    2e-14  33%  3eo3B  [x.x.x] BIFUNCTIONAL UDP-N-ACETYLGLUCOSAMINE 2-
    5e-14  34%  3eo3A  [x.x.x] BIFUNCTIONAL UDP-N-ACETYLGLUCOSAMINE 2-
    1e-12  32%  3eo3C  [x.x.x] BIFUNCTIONAL UDP-N-ACETYLGLUCOSAMINE 2-
    6e-12  26%  2hoeA  [x.x.x] N-ACETYLGLUCOSAMINE KINASE
    1e-11  30%  2qm1B  [x.x.x] GLUCOKINASE
    1e-11  30%  2qm1A  [x.x.x] GLUCOKINASE
    2e-11  31%  1z05A  [x.x.x] TRANSCRIPTIONAL REGULATOR, ROK FAMILY
    9e-10  32%  2ap1A  [x.x.x] PUTATIVE REGULATOR PROTEIN
    2e-07  22%  3bp8A  [x.x.x] PUTATIVE NAGC-LIKE TRANSCRIPTIONAL REGULATOR
    4e-07  22%  3bp8B  [x.x.x] PUTATIVE NAGC-LIKE TRANSCRIPTIONAL REGULATOR
    5e-05  28%  1xc3A  [c.55.1 - c.55.1] PUTATIVE FRUCTOKINASE
    1e-04  32%  1woqA  [c.55.1 - c.55.1] INORGANIC
:268

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxNRTVVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSEVEGI
3eo3B           ----------SALAVDLGGTNLRVAIVSMKGIVKKYTQFNPKTYEERINLILQMCVEAAAEAVKLNCRIL
3eo3A           ----------SALAVDLGGTNLRVAIVSMKGIVKKYTQFNPKTYEERINLILQMCVEAAAEAVKLNCRIL
3eo3C           ----------SALAVDLGNLRVAIVSMKGE-IVKKYTQFNPKTYEERINLILQMCVEAAAEAVKLNCRIL
2hoeA           -----------VLGIEVTRDEIAACLIDASNILAHEAHPLPSQSDREETNVYRIIDRAKDEKLGSKLSAL
2qm1B           --------DKKIIGIDLGGTTIKFAILTTDGVVQSIETNILEDGKHIVPSIIESIRHRI-DLYNKKEDFV
2qm1A           --------DKKIIGIDLGGTTIKFAILTTDGVVQSIETNILEDGKHIVPSIIESIRHRI-DLYNKKEDFV
1z05A           ------------------------------------------------------------------VTSI
2ap1A           --------NAMYYGFDIGGTKIALGVFDSTRRLQ--WEKRVPTPHTSYSAFLDAVCELVEEADQRGVKGV
3bp8A           --------------------------------------------------LLDRIISHIDQFFIERLTSI
3bp8B           --------------------------------------------------LLDRIISHIDQFFIERLTSI
1xc3A           -------------GIEAGGTKF----VCAVGREDGTII----DRIEFPTKMPDETIEKVIQYFSQSLQAI
1woqA           ---------------------------------------------------------------------V


                         .         .         *         .         .         .         .:140
query           GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGKQYENFVXXX
3eo3B           GVGIST---------------------DLRTPLSDTLHLPVWVDNDGNCAALAERKFGQGKGLENFVTLX
3eo3A           GVGIST---------------------DLRTPLSDTLHLPVWVDNDGNCAALAERKFGQGKGLENFVTLX
3eo3C           GVGIST---------------------DLRTPLSDTLHLPVWVDNDGNCAALAERKFGQGKGLENFVTLX
2hoeA           TVAAPGPIDTERGIIIDPRNFPLSQ-IPLANLLKEKYGIEVWVENDAD-GAVGEKWY--TKRDDSFAWXX
2qm1B           GIGTPGSVDIEKGTVVGAYNL-NWTTVQVKEQIESALGIPFALDNDANVAALGERWKGAGE---------
2qm1A           GIGTPGSVDIEKGTVVGAYNL-NWTTVQVKEQIESALGIPFALDNDANVAALGERWKGAGE---------
1z05A           AITLPGLVNSEQGIVYNVKNLALGPEIYKATGL------PVFVANDTRAWALAEKLFGHSQDVDNSVLIS
2ap1A           GIGIPGMPETEDGTLY-AANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFTQYPXXXXXX
3bp8A           AITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVV
3bp8B           AITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVV
1xc3A           GIGSFGPVDNDKGTITATPKA-GWRHYPFLQTVKNEMKIPVGFSTDVNAAALGEFLFGEAKGLDSCLYXX
1woqA           GVTFPGII--QHGVVHSAANVKSWLNTDIDALLTARLGRPVEVINDADAAGLAEARYGAG----------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXNKGSLLKDSNCGAGEFGMLPYLDGILEDYCSGQFFIKKIGVEGVEILKRARNNDKDTINI
3eo3B           XXXXXXXXXXHQHELIHGSSFCAAELGLVVSLDGCIEAYASGQREAKKLAVGALHLIQAAKLGNAKAQSI
3eo3A           XXXXXXXXXXHQHELIHGSSFCAAELGLVVSLDGCIEAYASGQREAKKLHVEGMSVIQAAKLGNAKAQSI
3eo3C           XXXXXXXXXXHQHELIHGSSFCAAELGLVVSLDGCIEAYASGMMSVPKEAVGALHLIQAAKLGNAKAQSI
2hoeA           XXXXXXXXXXXXXELYRGENGYAGEIGYTRVFNGFLEDVCNENVVLKHV-LSGFSLAEARDSGDVRVKEY
2qm1B           ----------------------------------------------------------------------
2qm1A           ----------------------------------------------------------------------
1z05A           IHHGLGAGIVLDGRVLQGRHGNIGELGHIQ-IDGCLETVASSQAIVEEISIE--DICAAAADGDPLAVDV
2ap1A           XXXXXXXXXXXXXKPITGQSYITGEFGRLPVQMGCIENYLSGRGFYYDQSLQAPEIIALWEQGDEQAHAH
3bp8A           IDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETISVDSILELAQLRLNQSDSLDI
3bp8B           IDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETISVDSILELAQLRLNQSMSSML
1xc3A           XXXXXXXXXXVEGRLLQGSHPEMGHIGKCPYHGDCFEGLASGPAIEARWGKKAADL--------SDIAQV
1woqA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YKQFGKHLGVAIKSIMYTLDPEVIIIAGSIISAREFFEKAMWDEIKTxxxxxxxxxxx
3eo3B           LRTAGTALGLGVVNILHTMNPSLVILSGVLAS--------------------------
3eo3A           LRTAGTALGLGVVNILHTMNPSLVILSGVLAS--------------------------
3eo3C           LRTAGTALGLGVVNILHTMNPSLVILSGVLAS--------------------------
2hoeA           FDDIARYFSIGLLNLIHLFGISKIVIGGFFKELGENFLKKIKIEVET-----------
2qm1B           ----------------------------------------------------------
2qm1A           ----------------------------------------------------------
1z05A           IQQLGRYLGAAIAIVINLFNPEKILIGGVINQAK------------------------
2ap1A           VERYLDLLAVCLGNILTIVDPDLLVIGGGL----------------------------
3bp8A           ITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIR------------
3bp8B           HGQVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIR------------
1xc3A           WELEGXXXXXXXXXXXXXXXPKKIILGGGVMQQKQVF---------------------
1woqA           ----------------------------------------------------------