[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:rpsF

[Show Plain Result]

#ERROR : Can't open dsspfile "1vs5F.bssp"
#ERROR : Can't open dsspfile "2gy9F.bssp"
#ERROR : Can't open dsspfile "2j5aA.bssp"
#ERROR : Can't open dsspfile "1risA.bssp"
#ERROR : Can't open dsspfile "2j00F.bssp"
#ERROR : Can't open dsspfile "1g1xA.bssp"
#ERROR : Can't open dsspfile "1louA.bssp"
#ERROR : Can't open dsspfile "2bvzA.bssp"
#ERROR : Can't open dsspfile "2bxjA.bssp"
#ERROR : Can't open dsspfile "1cqmA.bssp"
#ERROR : Can't open dsspfile "1vmbA.bssp"
#ERROR : Can't open dsspfile "1qjhA.bssp"
#ERROR : Can't open dsspfile "3bbnF.bssp"

## Summary of PDB Search
:111
    1e-34  58%  1vs5F  [x.x.x] 30S RIBOSOMAL PROTEIN S6
    7e-33  58%  2gy9F  [x.x.x] 30S RIBOSOMAL SUBUNIT PROTEIN S6
    3e-12  35%  2j5aA  [x.x.x] 30S RIBOSOMAL PROTEIN S6
    2e-10  31%  1risA  [i.1.1 (1fkaF)] RIBOSOMAL PROTEIN S6
    2e-10  31%  2j00F  [d.58.14 (1fjgF)] 30S RIBOSOMAL PROTEIN S6
    2e-10  31%  1g1xA  [d.58.14] 30S RIBOSOMAL PROTEIN S6
    4e-10  31%  1louA  [d.58.14] RIBOSOMAL PROTEIN S6
    6e-10  30%  2bvzA  [x.x.x] 30S RIBOSOMAL PROTEIN S6
    1e-09  30%  2bxjA  [x.x.x] 30S RIBOSOMAL PROTEIN S6
    3e-09  30%  1cqmA  [d.58.14] RIBOSOMAL PROTEIN S6
    8e-08  30%  1vmbA  [d.58.14] 30S RIBOSOMAL PROTEIN S6
    2e-07  29%  1qjhA  [d.58.14] RIBOSOMAL PROTEIN S6
    5e-04  28%  3bbnF  [x.x.x] RIBOSOMAL PROTEIN S6
:111

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKHYEVVLMIHPDQSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYVLFNIECPTES
1vs5F           MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
2gy9F           MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEV
2j5aA           LRYYETVFAVKPTLSEEMKKKFEQVKEFIKQKGGEILYEEDWGMRQLAYPIQKFNNARYFLVQFKTENPQ
1risA           MRRYEVNIVLNPNL-DQSQLALEKIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDR
2j00F           MRRYEVNIVLNPNL-DQSQLALEKIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDR
1g1xA           MRRYEVNIVLNPNL-DQSQLALEKIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDR
1louA           MRRYEVNIVLNPNL-DQSQLALEKIQRAAENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDR
2bvzA           MRRYEVNIVLNPNL-DQSQLALEKIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDR
2bxjA           MRRYEVNIVLNPNL-DQSQLALEKIQRAAENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDR
1cqmA           MRRYEVNIVLNPNL-DQSQLALEKIQRALENYGARVEKVAILGLRRLAYPIAKDPQGYFLWYQVEMPEDR
1vmbA           ---YESMFIIAPNPEEERENLVERVKKIIEERKGKIDKVERMGMRKFAYEIKKFNEGDYTVIYFRCDGQN
1qjhA           MRRYEVNIVLNPNL-DQSQLALEKIQRALENYGARVEKVAILGLMVLAYPIAKDPQGYFLWYQVEMPEDR
3bbnF           LRQYETMAVLRPDMTDERLTLTQKYEELLVAGGAMYVEVFNRGVIPLAYSIKRKNKAGYLLFTYFTKPES


                         .         .         *         .         .         .         .:140
query           LEKLQESLRYNDAILRRLVIATKEAITEPSxxxxxxxxxxx
1vs5F           IDELETTFRFNDAVIRSMVMRTKHAVTEAS-----------
2gy9F           IDELETTFRFNDAVIRSMVMRTKHA----------------
2j5aA           LNELDFQLKIDEDVIRWLNIQIKES----------------
1risA           VNDLARELRIRDNVRRVMVVKSQE-----------------
2j00F           VNDLARELRIRDNVRRVMVVKSQE-----------------
1g1xA           VNDLARELRIRDNVRRVMVVKSQE-----------------
1louA           VNDLARELRIRDNVRRVMVVKSQE-----------------
2bvzA           VNDAARELRIRDNVRRVMVVKSQE-----------------
2bxjA           VNDAARELRIRDNVRRVMVVKSQE-----------------
1cqmA           VNDLARELRIRDNVRRVMVVKSQE-----------------
1vmbA           LQELENFYRVTPEIIR-------------------------
1qjhA           VNDLARELRIRDNVRRVMVV---------------------
3bbnF           ISPLEAALVTDDDVIR-------------------------