[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:ACD30912.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2zk7B.bssp"
#ERROR : Can't open dsspfile "2dteA.bssp"
#ERROR : Can't open dsspfile "1i01E.bssp"
#ERROR : Can't open dsspfile "1q7bA.bssp"
#ERROR : Can't open dsspfile "1q7cA.bssp"
#ERROR : Can't open dsspfile "1q7bB.bssp"
#ERROR : Can't open dsspfile "1uznA.bssp"
#ERROR : Can't open dsspfile "2zk7A.bssp"
#ERROR : Can't open dsspfile "1i01B.bssp"
#ERROR : Can't open dsspfile "2uvdA.bssp"
#ERROR : Can't open dsspfile "2hq1A.bssp"
#ERROR : Can't open dsspfile "2p68A.bssp"
#ERROR : Can't open dsspfile "1i01A.bssp"
#ERROR : Can't open dsspfile "1uzlA.bssp"
#ERROR : Can't open dsspfile "1i01F.bssp"
#ERROR : Can't open dsspfile "1uzlB.bssp"
#ERROR : Can't open dsspfile "2ph3A.bssp"
#ERROR : Can't open dsspfile "1i01G.bssp"
#ERROR : Can't open dsspfile "1iy8A.bssp"
#ERROR : Can't open dsspfile "2c07A.bssp"
#ERROR : Can't open dsspfile "1uznB.bssp"
#ERROR : Can't open dsspfile "1i01H.bssp"
#ERROR : Can't open dsspfile "3gk3B.bssp"
#ERROR : Can't open dsspfile "1i01C.bssp"
#ERROR : Can't open dsspfile "3f9iA.bssp"
#ERROR : Can't open dsspfile "1uzmA.bssp"
#ERROR : Can't open dsspfile "1o5iA.bssp"
#ERROR : Can't open dsspfile "1i01D.bssp"
#ERROR : Can't open dsspfile "3gk3D.bssp"
#ERROR : Can't open dsspfile "1gegE.bssp"
#ERROR : Can't open dsspfile "1gegA.bssp"
#ERROR : Can't open dsspfile "3f9iB.bssp"
#ERROR : Can't open dsspfile "3gk3A.bssp"
#ERROR : Can't open dsspfile "2nm0A.bssp"
#ERROR : Can't open dsspfile "3gk3C.bssp"
#ERROR : Can't open dsspfile "2ntnA.bssp"
#ERROR : Can't open dsspfile "1edoA.bssp"
#ERROR : Can't open dsspfile "2ae2A.bssp"
#ERROR : Can't open dsspfile "1zemA.bssp"
#ERROR : Can't open dsspfile "2p68B.bssp"
#ERROR : Can't open dsspfile "2c7vB.bssp"
#ERROR : Can't open dsspfile "2d1yC.bssp"
#ERROR : Can't open dsspfile "2c7vA.bssp"
#ERROR : Can't open dsspfile "1vl8B.bssp"
#ERROR : Can't open dsspfile "1vl8A.bssp"
#ERROR : Can't open dsspfile "2d1yD.bssp"
#ERROR : Can't open dsspfile "2d1yB.bssp"
#ERROR : Can't open dsspfile "2d1yA.bssp"
#ERROR : Can't open dsspfile "2c7vD.bssp"
#ERROR : Can't open dsspfile "1ae1B.bssp"
#ERROR : Can't open dsspfile "3ftpA.bssp"
#ERROR : Can't open dsspfile "1xr3B.bssp"
#ERROR : Can't open dsspfile "3bmqA.bssp"
#ERROR : Can't open dsspfile "3imfA.bssp"
#ERROR : Can't open dsspfile "2ae1A.bssp"
#ERROR : Can't open dsspfile "2ph3B.bssp"
#ERROR : Can't open dsspfile "3bmeC.bssp"
#ERROR : Can't open dsspfile "2rhrB.bssp"
#ERROR : Can't open dsspfile "3imfB.bssp"
#ERROR : Can't open dsspfile "3i3oF.bssp"
#ERROR : Can't open dsspfile "3i3oE.bssp"
#ERROR : Can't open dsspfile "3i3oC.bssp"
#ERROR : Can't open dsspfile "3i3oB.bssp"
#ERROR : Can't open dsspfile "3i3oA.bssp"
#ERROR : Can't open dsspfile "3csdB.bssp"
#ERROR : Can't open dsspfile "2ntnB.bssp"
#ERROR : Can't open dsspfile "3ftpC.bssp"
#ERROR : Can't open dsspfile "3bmeA.bssp"
#ERROR : Can't open dsspfile "2c7vC.bssp"
#ERROR : Can't open dsspfile "1x7gB.bssp"
#ERROR : Can't open dsspfile "1w4zB.bssp"
#ERROR : Can't open dsspfile "1ulsB.bssp"
#ERROR : Can't open dsspfile "1ulsA.bssp"
#ERROR : Can't open dsspfile "3i3oH.bssp"
#ERROR : Can't open dsspfile "3bmfC.bssp"
#ERROR : Can't open dsspfile "3bmeB.bssp"
#ERROR : Can't open dsspfile "1xkqB.bssp"
#ERROR : Can't open dsspfile "1xkqA.bssp"
#ERROR : Can't open dsspfile "3d3wA.bssp"
#ERROR : Can't open dsspfile "3bmnD.bssp"
#ERROR : Can't open dsspfile "1uzmB.bssp"
#ERROR : Can't open dsspfile "3bmoB.bssp"
#ERROR : Can't open dsspfile "3bmjD.bssp"
#ERROR : Can't open dsspfile "3bmfB.bssp"
#ERROR : Can't open dsspfile "2wd7B.bssp"
#ERROR : Can't open dsspfile "3ftpD.bssp"
#ERROR : Can't open dsspfile "1fmcA.bssp"
#ERROR : Can't open dsspfile "3cxtA.bssp"
#ERROR : Can't open dsspfile "1ahhA.bssp"
#ERROR : Can't open dsspfile "1xg5C.bssp"
#ERROR : Can't open dsspfile "1x7hB.bssp"
#ERROR : Can't open dsspfile "1x7gA.bssp"
#ERROR : Can't open dsspfile "1w4zA.bssp"
#ERROR : Can't open dsspfile "2rhrA.bssp"
#ERROR : Can't open dsspfile "2rh4B.bssp"
#ERROR : Can't open dsspfile "2rh4A.bssp"
#ERROR : Can't open dsspfile "3cxrA.bssp"
#ERROR : Can't open dsspfile "1ae1A.bssp"
#ERROR : Can't open dsspfile "2z1nB.bssp"
#ERROR : Can't open dsspfile "3bmfD.bssp"
#ERROR : Can't open dsspfile "2wd7C.bssp"
#ERROR : Can't open dsspfile "3bmnA.bssp"
#ERROR : Can't open dsspfile "2z1nA.bssp"
#ERROR : Can't open dsspfile "3grpA.bssp"
#ERROR : Can't open dsspfile "1yxmD.bssp"
#ERROR : Can't open dsspfile "2pd6D.bssp"
#ERROR : Can't open dsspfile "3imfC.bssp"
#ERROR : Can't open dsspfile "3bmnC.bssp"
#ERROR : Can't open dsspfile "2pd6C.bssp"
#ERROR : Can't open dsspfile "3bmoC.bssp"
#ERROR : Can't open dsspfile "3bmoD.bssp"
#ERROR : Can't open dsspfile "3bmkC.bssp"
#ERROR : Can't open dsspfile "2yz7A.bssp"
#ERROR : Can't open dsspfile "2vz0B.bssp"
#ERROR : Can't open dsspfile "1ulsC.bssp"
#ERROR : Can't open dsspfile "3bmoA.bssp"
#ERROR : Can't open dsspfile "3bmnB.bssp"
#ERROR : Can't open dsspfile "3bmdB.bssp"
#ERROR : Can't open dsspfile "3ezlA.bssp"
#ERROR : Can't open dsspfile "3emkA.bssp"
#ERROR : Can't open dsspfile "1cydA.bssp"
#ERROR : Can't open dsspfile "1yxmA.bssp"
#ERROR : Can't open dsspfile "1pr9A.bssp"
#ERROR : Can't open dsspfile "2pd6B.bssp"
#ERROR : Can't open dsspfile "3ennA.bssp"
#ERROR : Can't open dsspfile "1xg5A.bssp"
#ERROR : Can't open dsspfile "2vz0A.bssp"
#ERROR : Can't open dsspfile "3ennB.bssp"
#ERROR : Can't open dsspfile "3bmiB.bssp"
#ERROR : Can't open dsspfile "3bmfA.bssp"
#ERROR : Can't open dsspfile "2ag5C.bssp"
#ERROR : Can't open dsspfile "2ag5B.bssp"
#ERROR : Can't open dsspfile "2ag5A.bssp"
#ERROR : Can't open dsspfile "3i3oG.bssp"
#ERROR : Can't open dsspfile "1yxmB.bssp"
#ERROR : Can't open dsspfile "3bmqC.bssp"
#ERROR : Can't open dsspfile "2ztmC.bssp"
#ERROR : Can't open dsspfile "1xg5B.bssp"
#ERROR : Can't open dsspfile "3emkD.bssp"
#ERROR : Can't open dsspfile "2ztvC.bssp"
#ERROR : Can't open dsspfile "2ztvB.bssp"
#ERROR : Can't open dsspfile "2pd6A.bssp"
#ERROR : Can't open dsspfile "3ennD.bssp"
#ERROR : Can't open dsspfile "3ennC.bssp"
#ERROR : Can't open dsspfile "2q2vD.bssp"
#ERROR : Can't open dsspfile "3emkC.bssp"
#ERROR : Can't open dsspfile "1hdcA.bssp"
#ERROR : Can't open dsspfile "3emkB.bssp"
#ERROR : Can't open dsspfile "2cfcA.bssp"
#ERROR : Can't open dsspfile "2a4kA.bssp"
#ERROR : Can't open dsspfile "2ztvD.bssp"
#ERROR : Can't open dsspfile "2q2wD.bssp"
#ERROR : Can't open dsspfile "2q2vC.bssp"
#ERROR : Can't open dsspfile "3ijrH.bssp"
#ERROR : Can't open dsspfile "3ijrF.bssp"
#ERROR : Can't open dsspfile "3ijrE.bssp"
#ERROR : Can't open dsspfile "3ijrB.bssp"
#ERROR : Can't open dsspfile "3ijrA.bssp"
#ERROR : Can't open dsspfile "3gafD.bssp"
#ERROR : Can't open dsspfile "3gafA.bssp"
#ERROR : Can't open dsspfile "2q2wC.bssp"
#ERROR : Can't open dsspfile "2zatA.bssp"
#ERROR : Can't open dsspfile "2q2qC.bssp"
#ERROR : Can't open dsspfile "2q2qA.bssp"
#ERROR : Can't open dsspfile "3gafF.bssp"
#ERROR : Can't open dsspfile "1w6uC.bssp"
#ERROR : Can't open dsspfile "1spxA.bssp"
#ERROR : Can't open dsspfile "1ybvA.bssp"
#ERROR : Can't open dsspfile "1w6uB.bssp"
#ERROR : Can't open dsspfile "2q2vB.bssp"
#ERROR : Can't open dsspfile "2q2qG.bssp"
#ERROR : Can't open dsspfile "2q2qE.bssp"
#ERROR : Can't open dsspfile "3gafG.bssp"
#ERROR : Can't open dsspfile "3gafE.bssp"
#ERROR : Can't open dsspfile "3gafC.bssp"
#ERROR : Can't open dsspfile "3gafB.bssp"
#ERROR : Can't open dsspfile "1g0oC.bssp"
#ERROR : Can't open dsspfile "1g0oA.bssp"
#ERROR : Can't open dsspfile "1dohB.bssp"
#ERROR : Can't open dsspfile "1dohA.bssp"
#ERROR : Can't open dsspfile "2ztmD.bssp"
#ERROR : Can't open dsspfile "2ztlA.bssp"
#ERROR : Can't open dsspfile "1w6uA.bssp"
#ERROR : Can't open dsspfile "3grpB.bssp"
#ERROR : Can't open dsspfile "2q2qB.bssp"
#ERROR : Can't open dsspfile "1h5qA.bssp"
#ERROR : Can't open dsspfile "3gafH.bssp"
#ERROR : Can't open dsspfile "1g0nB.bssp"
#ERROR : Can't open dsspfile "2q2wA.bssp"
#ERROR : Can't open dsspfile "2ztmA.bssp"
#ERROR : Can't open dsspfile "2q2qF.bssp"
#ERROR : Can't open dsspfile "2b4qA.bssp"
#ERROR : Can't open dsspfile "2q2vA.bssp"
#ERROR : Can't open dsspfile "2q2qH.bssp"
#ERROR : Can't open dsspfile "2ztuD.bssp"
#ERROR : Can't open dsspfile "2ztmB.bssp"
#ERROR : Can't open dsspfile "1x1tA.bssp"
#ERROR : Can't open dsspfile "1w6uD.bssp"
#ERROR : Can't open dsspfile "2ztuC.bssp"
#ERROR : Can't open dsspfile "3grpC.bssp"
#ERROR : Can't open dsspfile "1yxmC.bssp"
#ERROR : Can't open dsspfile "1x1eA.bssp"
#ERROR : Can't open dsspfile "2ekpA.bssp"
#ERROR : Can't open dsspfile "1xhlA.bssp"
#ERROR : Can't open dsspfile "2ekqD.bssp"
#ERROR : Can't open dsspfile "2ztuB.bssp"
#ERROR : Can't open dsspfile "1ydeP.bssp"
#ERROR : Can't open dsspfile "1ydeN.bssp"
#ERROR : Can't open dsspfile "1ydeM.bssp"
#ERROR : Can't open dsspfile "1ydeI.bssp"
#ERROR : Can't open dsspfile "1ydeH.bssp"
#ERROR : Can't open dsspfile "1ydeG.bssp"
#ERROR : Can't open dsspfile "1ydeF.bssp"
#ERROR : Can't open dsspfile "1ydeD.bssp"
#ERROR : Can't open dsspfile "1ydeB.bssp"
#ERROR : Can't open dsspfile "1ydeA.bssp"
#ERROR : Can't open dsspfile "3grpD.bssp"
#ERROR : Can't open dsspfile "1ja9A.bssp"
#ERROR : Can't open dsspfile "2ztuA.bssp"
#ERROR : Can't open dsspfile "1k2wA.bssp"
#ERROR : Can't open dsspfile "2b4qB.bssp"
#ERROR : Can't open dsspfile "2ewmB.bssp"
#ERROR : Can't open dsspfile "1zjyA.bssp"
#ERROR : Can't open dsspfile "1nxqA.bssp"
#ERROR : Can't open dsspfile "2ewmA.bssp"
#ERROR : Can't open dsspfile "2bgkA.bssp"
#ERROR : Can't open dsspfile "2ew8A.bssp"
#ERROR : Can't open dsspfile "2ew8B.bssp"
#ERROR : Can't open dsspfile "1e6wA.bssp"
#ERROR : Can't open dsspfile "3iccA.bssp"
#ERROR : Can't open dsspfile "3i4fC.bssp"
#ERROR : Can't open dsspfile "3i4fD.bssp"
#ERROR : Can't open dsspfile "3i4fA.bssp"
#ERROR : Can't open dsspfile "1e3wA.bssp"
#ERROR : Can't open dsspfile "1w73A.bssp"
#ERROR : Can't open dsspfile "1nffA.bssp"
#ERROR : Can't open dsspfile "3gvcD.bssp"
#ERROR : Can't open dsspfile "2et6A.bssp"
#ERROR : Can't open dsspfile "1e6wD.bssp"
#ERROR : Can't open dsspfile "3gvcC.bssp"
#ERROR : Can't open dsspfile "3gvcB.bssp"
#ERROR : Can't open dsspfile "1w73C.bssp"
#ERROR : Can't open dsspfile "3gvcA.bssp"
#ERROR : Can't open dsspfile "1w73D.bssp"
#ERROR : Can't open dsspfile "1p33C.bssp"
#ERROR : Can't open dsspfile "1p33B.bssp"
#ERROR : Can't open dsspfile "1p33A.bssp"
#ERROR : Can't open dsspfile "3gedB.bssp"
#ERROR : Can't open dsspfile "3gedA.bssp"
#ERROR : Can't open dsspfile "1p33D.bssp"
#ERROR : Can't open dsspfile "1e6wC.bssp"
#ERROR : Can't open dsspfile "2a4kB.bssp"
#ERROR : Can't open dsspfile "1xq1A.bssp"
#ERROR : Can't open dsspfile "1w73B.bssp"
#ERROR : Can't open dsspfile "1uluB.bssp"
#ERROR : Can't open dsspfile "1e6wB.bssp"
#ERROR : Can't open dsspfile "1rwbA.bssp"
#ERROR : Can't open dsspfile "2qioA.bssp"
#ERROR : Can't open dsspfile "3gegA.bssp"
#ERROR : Can't open dsspfile "2dknA.bssp"
#ERROR : Can't open dsspfile "1g6kA.bssp"
#ERROR : Can't open dsspfile "1nfrA.bssp"
#ERROR : Can't open dsspfile "1u7tA.bssp"
#ERROR : Can't open dsspfile "3diiA.bssp"
#ERROR : Can't open dsspfile "1pwxA.bssp"
#ERROR : Can't open dsspfile "1mxfA.bssp"
#ERROR : Can't open dsspfile "1geeA.bssp"
#ERROR : Can't open dsspfile "1e3sA.bssp"
#ERROR : Can't open dsspfile "3ctmA.bssp"
#ERROR : Can't open dsspfile "1uayB.bssp"
#ERROR : Can't open dsspfile "1gcoA.bssp"
#ERROR : Can't open dsspfile "1uayA.bssp"
#ERROR : Can't open dsspfile "2qhxC.bssp"
#ERROR : Can't open dsspfile "3dijA.bssp"
#ERROR : Can't open dsspfile "1uluA.bssp"
#ERROR : Can't open dsspfile "1zmoA.bssp"
#ERROR : Can't open dsspfile "2jjyC.bssp"
#ERROR : Can't open dsspfile "2jjyB.bssp"
#ERROR : Can't open dsspfile "3ctmF.bssp"
#ERROR : Can't open dsspfile "2jjyA.bssp"
#ERROR : Can't open dsspfile "2bf7C.bssp"
#ERROR : Can't open dsspfile "2o23B.bssp"
#ERROR : Can't open dsspfile "2o23A.bssp"
#ERROR : Can't open dsspfile "1mxhA.bssp"
#ERROR : Can't open dsspfile "1e7wB.bssp"
#ERROR : Can't open dsspfile "2b37B.bssp"
#ERROR : Can't open dsspfile "3ek2C.bssp"
#ERROR : Can't open dsspfile "3ctmH.bssp"
#ERROR : Can't open dsspfile "3ctmD.bssp"
#ERROR : Can't open dsspfile "3ctmB.bssp"
#ERROR : Can't open dsspfile "1zbqA.bssp"
#ERROR : Can't open dsspfile "1uluD.bssp"
#ERROR : Can't open dsspfile "2p8kH.bssp"
#ERROR : Can't open dsspfile "2jjyD.bssp"
#ERROR : Can't open dsspfile "2fwmX.bssp"
#ERROR : Can't open dsspfile "3ek2A.bssp"
#ERROR : Can't open dsspfile "2yw9H.bssp"
#ERROR : Can't open dsspfile "2p8kC.bssp"
#ERROR : Can't open dsspfile "2bfmC.bssp"
#ERROR : Can't open dsspfile "2bf7B.bssp"
#ERROR : Can't open dsspfile "1uluC.bssp"
#ERROR : Can't open dsspfile "3ctmE.bssp"
#ERROR : Can't open dsspfile "1w0cG.bssp"
#ERROR : Can't open dsspfile "2qhxA.bssp"
#ERROR : Can't open dsspfile "3ek2D.bssp"
#ERROR : Can't open dsspfile "3ctmC.bssp"
#ERROR : Can't open dsspfile "2bfoC.bssp"
#ERROR : Can't open dsspfile "2bf7D.bssp"
#ERROR : Can't open dsspfile "2qhxD.bssp"
#ERROR : Can't open dsspfile "1e7wA.bssp"
#ERROR : Can't open dsspfile "2bfaC.bssp"
#ERROR : Can't open dsspfile "2p8kG.bssp"
#ERROR : Can't open dsspfile "2p8kD.bssp"
#ERROR : Can't open dsspfile "3ek2B.bssp"
#ERROR : Can't open dsspfile "1e92B.bssp"
#ERROR : Can't open dsspfile "2bfaD.bssp"
#ERROR : Can't open dsspfile "2yw9B.bssp"
#ERROR : Can't open dsspfile "1lxcA.bssp"
#ERROR : Can't open dsspfile "1e92D.bssp"
#ERROR : Can't open dsspfile "1e92C.bssp"
#ERROR : Can't open dsspfile "3ctmG.bssp"
#ERROR : Can't open dsspfile "2bfpD.bssp"
#ERROR : Can't open dsspfile "2b35B.bssp"
#ERROR : Can't open dsspfile "1w0cH.bssp"
#ERROR : Can't open dsspfile "1w0cC.bssp"
#ERROR : Can't open dsspfile "2bfpB.bssp"
#ERROR : Can't open dsspfile "2bfaB.bssp"
#ERROR : Can't open dsspfile "2bfaA.bssp"
#ERROR : Can't open dsspfile "2bf7A.bssp"
#ERROR : Can't open dsspfile "1w0cF.bssp"
#ERROR : Can't open dsspfile "1w0cE.bssp"
#ERROR : Can't open dsspfile "1w0cB.bssp"
#ERROR : Can't open dsspfile "1w0cA.bssp"
#ERROR : Can't open dsspfile "2p8kB.bssp"
#ERROR : Can't open dsspfile "2p8kA.bssp"
#ERROR : Can't open dsspfile "2gdzA.bssp"
#ERROR : Can't open dsspfile "1e92A.bssp"
#ERROR : Can't open dsspfile "2bfoA.bssp"
#ERROR : Can't open dsspfile "2bfmB.bssp"
#ERROR : Can't open dsspfile "2o2sA.bssp"
#ERROR : Can't open dsspfile "1fk8A.bssp"
#ERROR : Can't open dsspfile "1dfiA.bssp"
#ERROR : Can't open dsspfile "1bdbA.bssp"
#ERROR : Can't open dsspfile "2b35F.bssp"
#ERROR : Can't open dsspfile "2b35D.bssp"
#ERROR : Can't open dsspfile "2b35C.bssp"
#ERROR : Can't open dsspfile "2yw9D.bssp"
#ERROR : Can't open dsspfile "1i30A.bssp"
#ERROR : Can't open dsspfile "3fnfB.bssp"
#ERROR : Can't open dsspfile "2yw9F.bssp"
#ERROR : Can't open dsspfile "1qsgG.bssp"
#ERROR : Can't open dsspfile "1qsgA.bssp"
#ERROR : Can't open dsspfile "1qg6A.bssp"
#ERROR : Can't open dsspfile "1hxhA.bssp"
#ERROR : Can't open dsspfile "2fhsB.bssp"
#ERROR : Can't open dsspfile "2ehdB.bssp"
#ERROR : Can't open dsspfile "1c14A.bssp"
#ERROR : Can't open dsspfile "2yw9E.bssp"
#ERROR : Can't open dsspfile "2yw9A.bssp"
#ERROR : Can't open dsspfile "1yb1A.bssp"
#ERROR : Can't open dsspfile "1gz6A.bssp"
#ERROR : Can't open dsspfile "2aqiA.bssp"
#ERROR : Can't open dsspfile "2h7iA.bssp"
#ERROR : Can't open dsspfile "1gz6C.bssp"
#ERROR : Can't open dsspfile "1gz6B.bssp"
#ERROR : Can't open dsspfile "1fduC.bssp"
#ERROR : Can't open dsspfile "1enyA.bssp"
#ERROR : Can't open dsspfile "1bhsA.bssp"
#ERROR : Can't open dsspfile "2b36B.bssp"
#ERROR : Can't open dsspfile "2b35A.bssp"
#ERROR : Can't open dsspfile "2aqhA.bssp"
#ERROR : Can't open dsspfile "2aq8A.bssp"
#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "2yw9C.bssp"
#ERROR : Can't open dsspfile "2p91A.bssp"
#ERROR : Can't open dsspfile "1iolA.bssp"
#ERROR : Can't open dsspfile "3fneB.bssp"
#ERROR : Can't open dsspfile "2ehdA.bssp"
#ERROR : Can't open dsspfile "2b35E.bssp"
#ERROR : Can't open dsspfile "2p91B.bssp"
#ERROR : Can't open dsspfile "1fdvB.bssp"
#ERROR : Can't open dsspfile "2dknB.bssp"
#ERROR : Can't open dsspfile "2nv6A.bssp"
#ERROR : Can't open dsspfile "2aqkA.bssp"
#ERROR : Can't open dsspfile "3fnfD.bssp"
#ERROR : Can't open dsspfile "2b37C.bssp"
#ERROR : Can't open dsspfile "2p91D.bssp"
#ERROR : Can't open dsspfile "1lx6A.bssp"
#ERROR : Can't open dsspfile "3fneD.bssp"
#ERROR : Can't open dsspfile "1fjhA.bssp"
#ERROR : Can't open dsspfile "3fnfC.bssp"
#ERROR : Can't open dsspfile "3fneC.bssp"
#ERROR : Can't open dsspfile "2o2sB.bssp"
#ERROR : Can't open dsspfile "1fduD.bssp"
#ERROR : Can't open dsspfile "1fduB.bssp"
#ERROR : Can't open dsspfile "1fduA.bssp"
#ERROR : Can't open dsspfile "1fdsA.bssp"
#ERROR : Can't open dsspfile "1yb1B.bssp"
#ERROR : Can't open dsspfile "1qyxA.bssp"
#ERROR : Can't open dsspfile "1qyvA.bssp"
#ERROR : Can't open dsspfile "1jtvA.bssp"
#ERROR : Can't open dsspfile "1fdwA.bssp"
#ERROR : Can't open dsspfile "3deyX.bssp"
#ERROR : Can't open dsspfile "2p91C.bssp"
#ERROR : Can't open dsspfile "2ntvA.bssp"
#ERROR : Can't open dsspfile "2japC.bssp"
#ERROR : Can't open dsspfile "2japA.bssp"
#ERROR : Can't open dsspfile "3edmB.bssp"
#ERROR : Can't open dsspfile "3edmA.bssp"
#ERROR : Can't open dsspfile "1uh5A.bssp"
#ERROR : Can't open dsspfile "2op0B.bssp"
#ERROR : Can't open dsspfile "2oosB.bssp"
#ERROR : Can't open dsspfile "2oosA.bssp"
#ERROR : Can't open dsspfile "2ol4B.bssp"
#ERROR : Can't open dsspfile "2ol4A.bssp"
#ERROR : Can't open dsspfile "1enoA.bssp"
#ERROR : Can't open dsspfile "1d7oA.bssp"
#ERROR : Can't open dsspfile "1cwuA.bssp"
#ERROR : Can't open dsspfile "1vrwA.bssp"
#ERROR : Can't open dsspfile "2pd3A.bssp"
#ERROR : Can't open dsspfile "2o2yD.bssp"
#ERROR : Can't open dsspfile "1zxlA.bssp"
#ERROR : Can't open dsspfile "1zsnA.bssp"
#ERROR : Can't open dsspfile "2o2yC.bssp"
#ERROR : Can't open dsspfile "2o2yA.bssp"
#ERROR : Can't open dsspfile "1so8A.bssp"
#ERROR : Can't open dsspfile "3gy0A.bssp"
#ERROR : Can't open dsspfile "3f5sB.bssp"
#ERROR : Can't open dsspfile "3f5sA.bssp"
#ERROR : Can't open dsspfile "2o50A.bssp"
#ERROR : Can't open dsspfile "2jahC.bssp"
#ERROR : Can't open dsspfile "2jahA.bssp"
#ERROR : Can't open dsspfile "2qq5A.bssp"
#ERROR : Can't open dsspfile "3g1tA.bssp"
#ERROR : Can't open dsspfile "3f1lB.bssp"
#ERROR : Can't open dsspfile "3f1lA.bssp"
#ERROR : Can't open dsspfile "2o50B.bssp"
#ERROR : Can't open dsspfile "3k2eA.bssp"
#ERROR : Can't open dsspfile "3grkD.bssp"
#ERROR : Can't open dsspfile "3grkA.bssp"
#ERROR : Can't open dsspfile "3gz4B.bssp"
#ERROR : Can't open dsspfile "3gz4A.bssp"
#ERROR : Can't open dsspfile "3e9nA.bssp"
#ERROR : Can't open dsspfile "2bd0A.bssp"
#ERROR : Can't open dsspfile "3guyH.bssp"
#ERROR : Can't open dsspfile "3guyG.bssp"
#ERROR : Can't open dsspfile "3guyD.bssp"
#ERROR : Can't open dsspfile "3guyC.bssp"
#ERROR : Can't open dsspfile "3grkB.bssp"
#ERROR : Can't open dsspfile "3f5qB.bssp"
#ERROR : Can't open dsspfile "3f5qA.bssp"
#ERROR : Can't open dsspfile "3grkG.bssp"
#ERROR : Can't open dsspfile "3e9nC.bssp"
#ERROR : Can't open dsspfile "3k2eB.bssp"
#ERROR : Can't open dsspfile "3guyA.bssp"

## Summary of PDB Search
:235
    7e-30  35%  2zk7B  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    7e-30  35%  2dteA  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    2e-29  35%  1i01E  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    3e-29  34%  1q7bA  [c.2.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    8e-29  34%  1q7cA  [c.2.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    4e-28  34%  1q7bB  [c.2.1] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    2e-27  31%  1uznA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    3e-27  36%  2zk7A  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    9e-27  35%  1i01B  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    1e-26  32%  2uvdA  [x.x.x] 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
    6e-26  34%  2hq1A  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    8e-26  34%  2p68A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    1e-25  35%  1i01A  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    2e-25  32%  1uzlA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    2e-25  35%  1i01F  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    2e-25  33%  1uzlB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    3e-25  37%  2ph3A  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    4e-25  35%  1i01G  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    7e-25  33%  1iy8A  [c.2.1] LEVODIONE REDUCTASE
    9e-25  32%  2c07A  [x.x.x] 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE
    1e-24  32%  1uznB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    1e-24  35%  1i01H  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    1e-24  35%  3gk3B  [x.x.x] ACETOACETYL-COA REDUCTASE
    1e-24  35%  1i01C  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    1e-24  35%  3f9iA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-24  31%  1uzmA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    3e-24  32%  1o5iA  [c.2.1] 3-OXOACYL-(ACYL CARRIER PROTEIN) REDUCTASE
    3e-24  35%  1i01D  [c.2.1] BETA-KETOACYL [ACP] REDUCTASE
    3e-24  33%  3gk3D  [x.x.x] ACETOACETYL-COA REDUCTASE
    3e-24  33%  1gegE  [c.2.1] ACETOIN REDUCTASE
    3e-24  33%  1gegA  [c.2.1] ACETOIN REDUCTASE
    4e-24  32%  3f9iB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    6e-24  35%  3gk3A  [x.x.x] ACETOACETYL-COA REDUCTASE
    1e-23  34%  2nm0A  [x.x.x] PROBABLE 3-OXACYL-(ACYL-CARRIER-PROTEIN)
    1e-23  35%  3gk3C  [x.x.x] ACETOACETYL-COA REDUCTASE
    1e-23  34%  2ntnA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-23  33%  1edoA  [c.2.1] BETA-KETO ACYL CARRIER PROTEIN REDUCTASE
    3e-23  32%  2ae2A  [c.2.1] PROTEIN (TROPINONE REDUCTASE-II)
    5e-23  33%  1zemA  [x.x.x] XYLITOL DEHYDROGENASE
    5e-23  34%  2p68B  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    5e-23  35%  2c7vB  [x.x.x] PTERIDINE REDUCTASE
    6e-23  35%  2d1yC  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    8e-23  35%  2c7vA  [x.x.x] PTERIDINE REDUCTASE
    1e-22  30%  1vl8B  [c.2.1] GLUCONATE 5-DEHYDROGENASE
    1e-22  30%  1vl8A  [c.2.1] GLUCONATE 5-DEHYDROGENASE
    1e-22  37%  2d1yD  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    2e-22  37%  2d1yB  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    2e-22  36%  2d1yA  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    2e-22  35%  2c7vD  [x.x.x] PTERIDINE REDUCTASE
    2e-22  33%  1ae1B  [c.2.1] TROPINONE REDUCTASE-I
    3e-22  29%  3ftpA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    5e-22  30%  1xr3B  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    7e-22  35%  3bmqA  [x.x.x] PTERIDINE REDUCTASE
    9e-22  38%  3imfA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    9e-22  30%  2ae1A  [x.x.x] TROPINONE REDUCTASE-II
    2e-21  36%  2ph3B  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    2e-21  35%  3bmeC  [x.x.x] PTERIDINE REDUCTASE
    2e-21  30%  2rhrB  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    2e-21  39%  3imfB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-21  36%  3i3oF  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-21  36%  3i3oE  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-21  36%  3i3oC  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-21  36%  3i3oB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-21  36%  3i3oA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-21  30%  3csdB  [x.x.x] PUTATIVE KETOACYL REDUCTASE
    3e-21  35%  2ntnB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    3e-21  29%  3ftpC  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    3e-21  35%  3bmeA  [x.x.x] PTERIDINE REDUCTASE
    4e-21  35%  2c7vC  [x.x.x] PTERIDINE REDUCTASE
    6e-21  31%  1x7gB  [c.2.1] PUTATIVE KETOACYL REDUCTASE
    6e-21  30%  1w4zB  [c.2.1] KETOACYL REDUCTASE
    6e-21  33%  1ulsB  [c.2.1] PUTATIVE 3-OXOACYL-ACYL CARRIER PROTEIN
    6e-21  33%  1ulsA  [c.2.1] PUTATIVE 3-OXOACYL-ACYL CARRIER PROTEIN
    6e-21  35%  3i3oH  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-21  35%  3bmfC  [x.x.x] PTERIDINE REDUCTASE
    6e-21  35%  3bmeB  [x.x.x] PTERIDINE REDUCTASE
    8e-21  34%  1xkqB  [c.2.1] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5D234)
    8e-21  34%  1xkqA  [c.2.1] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5D234)
    8e-21  31%  3d3wA  [x.x.x] L-XYLULOSE REDUCTASE
    8e-21  35%  3bmnD  [x.x.x] PTERIDINE REDUCTASE
    1e-20  33%  1uzmB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    1e-20  36%  3bmoB  [x.x.x] PTERIDINE REDUCTASE
    1e-20  35%  3bmjD  [x.x.x] PTERIDINE REDUCTASE
    1e-20  36%  3bmfB  [x.x.x] PTERIDINE REDUCTASE
    1e-20  36%  2wd7B  [x.x.x] PTERIDINE REDUCTASE
    1e-20  29%  3ftpD  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    1e-20  32%  1fmcA  [c.2.1] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-20  29%  3cxtA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    1e-20  32%  1ahhA  [c.2.1] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-20  33%  1xg5C  [c.2.1] ARPG836
    2e-20  32%  1x7hB  [c.2.1] PUTATIVE KETOACYL REDUCTASE
    2e-20  32%  1x7gA  [c.2.1] PUTATIVE KETOACYL REDUCTASE
    2e-20  32%  1w4zA  [c.2.1] KETOACYL REDUCTASE
    2e-20  32%  2rhrA  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    2e-20  32%  2rh4B  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    2e-20  32%  2rh4A  [x.x.x] ACTINORHODIN POLYKETIDE KETOREDUCTASE
    2e-20  28%  3cxrA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    2e-20  33%  1ae1A  [c.2.1] TROPINONE REDUCTASE-I
    2e-20  30%  2z1nB  [x.x.x] DEHYDROGENASE
    2e-20  35%  3bmfD  [x.x.x] PTERIDINE REDUCTASE
    3e-20  35%  2wd7C  [x.x.x] PTERIDINE REDUCTASE
    3e-20  35%  3bmnA  [x.x.x] PTERIDINE REDUCTASE
    4e-20  31%  2z1nA  [x.x.x] DEHYDROGENASE
    4e-20  35%  3grpA  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    5e-20  30%  1yxmD  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    5e-20  30%  2pd6D  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 8
    5e-20  38%  3imfC  [x.x.x] SHORT CHAIN DEHYDROGENASE
    5e-20  36%  3bmnC  [x.x.x] PTERIDINE REDUCTASE
    6e-20  31%  2pd6C  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 8
    6e-20  36%  3bmoC  [x.x.x] PTERIDINE REDUCTASE
    8e-20  36%  3bmoD  [x.x.x] PTERIDINE REDUCTASE
    8e-20  36%  3bmkC  [x.x.x] PTERIDINE REDUCTASE
    1e-19  31%  2yz7A  [x.x.x] D-3-HYDROXYBUTYRATE DEHYDROGENASE
    1e-19  36%  2vz0B  [x.x.x] PTERIDINE REDUCTASE
    1e-19  35%  1ulsC  [c.2.1] PUTATIVE 3-OXOACYL-ACYL CARRIER PROTEIN
    1e-19  35%  3bmoA  [x.x.x] PTERIDINE REDUCTASE
    1e-19  36%  3bmnB  [x.x.x] PTERIDINE REDUCTASE
    1e-19  35%  3bmdB  [x.x.x] PTERIDINE REDUCTASE
    1e-19  32%  3ezlA  [x.x.x] ACETOACETYL-COA REDUCTASE
    1e-19  29%  3emkA  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    1e-19  32%  1cydA  [c.2.1] CARBONYL REDUCTASE
    2e-19  30%  1yxmA  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    2e-19  31%  1pr9A  [c.2.1] L-XYLULOSE REDUCTASE
    2e-19  31%  2pd6B  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 8
    2e-19  30%  3ennA  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    2e-19  33%  1xg5A  [c.2.1] ARPG836
    2e-19  36%  2vz0A  [x.x.x] PTERIDINE REDUCTASE
    2e-19  29%  3ennB  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    2e-19  35%  3bmiB  [x.x.x] PTERIDINE REDUCTASE
    2e-19  34%  3bmfA  [x.x.x] PTERIDINE REDUCTASE
    2e-19  38%  2ag5C  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    2e-19  38%  2ag5B  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    2e-19  38%  2ag5A  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    3e-19  35%  3i3oG  [x.x.x] SHORT CHAIN DEHYDROGENASE
    4e-19  31%  1yxmB  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    4e-19  36%  3bmqC  [x.x.x] PTERIDINE REDUCTASE
    5e-19  36%  2ztmC  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    5e-19  35%  1xg5B  [c.2.1] ARPG836
    5e-19  29%  3emkD  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    7e-19  35%  2ztvC  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    7e-19  36%  2ztvB  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    9e-19  31%  2pd6A  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 8
    9e-19  30%  3ennD  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    9e-19  30%  3ennC  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    1e-18  27%  2q2vD  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-18  30%  3emkC  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    2e-18  33%  1hdcA  [c.2.1] 3-ALPHA, 20 BETA-HYDROXYSTEROID DEHYDROGENASE
    2e-18  30%  3emkB  [x.x.x] GLUCOSE/RIBITOL DEHYDROGENASE
    2e-18  29%  2cfcA  [x.x.x] 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE
    4e-18  29%  2a4kA  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    5e-18  34%  2ztvD  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    6e-18  27%  2q2wD  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    6e-18  27%  2q2vC  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    6e-18  36%  3ijrH  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    6e-18  36%  3ijrF  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    6e-18  36%  3ijrE  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    6e-18  36%  3ijrB  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    6e-18  36%  3ijrA  [x.x.x] OXIDOREDUCTASE, SHORT CHAIN
    6e-18  31%  3gafD  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    6e-18  31%  3gafA  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    8e-18  27%  2q2wC  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-17  28%  2zatA  [x.x.x] DEHYDROGENASE/REDUCTASE SDR FAMILY MEMBER 4
    1e-17  27%  2q2qC  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-17  27%  2q2qA  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-17  31%  3gafF  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-17  31%  1w6uC  [c.2.1] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    1e-17  32%  1spxA  [c.2.1] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5L265)
    2e-17  26%  1ybvA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    2e-17  32%  1w6uB  [c.2.1] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    2e-17  28%  2q2vB  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    2e-17  28%  2q2qG  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    2e-17  27%  2q2qE  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    2e-17  32%  3gafG  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-17  33%  3gafE  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-17  32%  3gafC  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-17  32%  3gafB  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-17  26%  1g0oC  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    2e-17  26%  1g0oA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    2e-17  26%  1dohB  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    2e-17  26%  1dohA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    2e-17  34%  2ztmD  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    2e-17  36%  2ztlA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    3e-17  31%  1w6uA  [c.2.1] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    3e-17  37%  3grpB  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    4e-17  28%  2q2qB  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    4e-17  27%  1h5qA  [c.2.1] NADP-DEPENDENT MANNITOL DEHYDROGENASE
    4e-17  32%  3gafH  [x.x.x] 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    4e-17  25%  1g0nB  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    5e-17  28%  2q2wA  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    7e-17  35%  2ztmA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    7e-17  28%  2q2qF  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    7e-17  32%  2b4qA  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    9e-17  28%  2q2vA  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    9e-17  27%  2q2qH  [x.x.x] BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    1e-16  36%  2ztuD  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    1e-16  35%  2ztmB  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    1e-16  36%  1x1tA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    1e-16  31%  1w6uD  [c.2.1] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    2e-16  33%  2ztuC  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    3e-16  40%  3grpC  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    3e-16  33%  1yxmC  [x.x.x] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE
    3e-16  46%  1x1eA  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    3e-16  46%  2ekpA  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    6e-16  29%  1xhlA  [c.2.1] SHORT-CHAIN DEHYDROGENASE/REDUCTASE FAMILY
    7e-16  48%  2ekqD  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    1e-15  36%  2ztuB  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    1e-15  29%  1ydeP  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-15  30%  1ydeN  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-15  29%  1ydeM  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-15  29%  1ydeI  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-15  29%  1ydeH  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-15  29%  1ydeG  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-15  29%  1ydeF  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-15  29%  1ydeD  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-15  30%  1ydeB  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-15  29%  1ydeA  [x.x.x] RETINAL DEHYDROGENASE/REDUCTASE 3
    1e-15  41%  3grpD  [x.x.x] 3-OXOACYL-(ACYL CARRIERPROTEIN) REDUCTASE
    2e-15  26%  1ja9A  [c.2.1] 1,3,6,8-TETRAHYDROXYNAPHTHALENE REDUCTASE
    2e-15  34%  2ztuA  [x.x.x] D(-)-3-HYDROXYBUTYRATE DEHYDROGENASE
    2e-15  31%  1k2wA  [c.2.1] SORBITOL DEHYDROGENASE
    2e-15  33%  2b4qB  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    5e-15  27%  2ewmB  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    8e-15  28%  1zjyA  [x.x.x] R-SPECIFIC ALCOHOL DEHYDROGENASE
    8e-15  28%  1nxqA  [c.2.1] R-ALCOHOL DEHYDROGENASE
    2e-14  28%  2ewmA  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    2e-14  27%  2bgkA  [x.x.x] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
    3e-14  28%  2ew8A  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    5e-14  28%  2ew8B  [x.x.x] (S)-1-PHENYLETHANOL DEHYDROGENASE
    5e-14  34%  1e6wA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    9e-14  31%  3iccA  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL CARRIER PROTEIN)
    1e-13  29%  3i4fC  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    2e-13  29%  3i4fD  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    2e-13  29%  3i4fA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
    3e-13  33%  1e3wA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    4e-13  32%  1w73A  [c.2.1] 2,4-DIENOYL-COA REDUCTASE
    4e-13  30%  1nffA  [c.2.1] PUTATIVE OXIDOREDUCTASE RV2002
    4e-13  28%  3gvcD  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    6e-13  31%  2et6A  [x.x.x] (3R)-HYDROXYACYL-COA DEHYDROGENASE
    8e-13  34%  1e6wD  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    1e-12  27%  3gvcC  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    1e-12  27%  3gvcB  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    2e-12  33%  1w73C  [c.2.1] 2,4-DIENOYL-COA REDUCTASE
    2e-12  26%  3gvcA  [x.x.x] PROBABLE SHORT-CHAIN TYPE
    3e-12  34%  1w73D  [c.2.1] 2,4-DIENOYL-COA REDUCTASE
    3e-12  32%  1p33C  [c.2.1] PTERIDINE REDUCTASE 1
    3e-12  32%  1p33B  [c.2.1] PTERIDINE REDUCTASE 1
    3e-12  32%  1p33A  [c.2.1] PTERIDINE REDUCTASE 1
    3e-12  30%  3gedB  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    3e-12  30%  3gedA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    4e-12  32%  1p33D  [c.2.1] PTERIDINE REDUCTASE 1
    4e-12  33%  1e6wC  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    5e-12  51%  2a4kB  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    6e-12  35%  1xq1A  [c.2.1] PUTATIVE TROPINONE REDUCATSE
    6e-12  33%  1w73B  [c.2.1] 2,4-DIENOYL-COA REDUCTASE
    6e-12  30%  1uluB  [c.2.1] ENOYL-ACYL CARRIER PROTEIN REDUCTASE
    6e-12  33%  1e6wB  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    8e-12  26%  1rwbA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    8e-12  31%  2qioA  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
    8e-12  30%  3gegA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    8e-12  31%  2dknA  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-11  26%  1g6kA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    1e-11  31%  1nfrA  [c.2.1] PUTATIVE OXIDOREDUCTASE RV2002
    2e-11  35%  1u7tA  [c.2.1] 3-HYDROXYACYL-COA DEHYDROGENASE TYPE II
    2e-11  30%  3diiA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    2e-11  28%  1pwxA  [c.2.1] HALOHYDRIN DEHALOGENASE
    2e-11  31%  1mxfA  [c.2.1] PTERIDINE REDUCTASE 2
    2e-11  26%  1geeA  [c.2.1] GLUCOSE 1-DEHYDROGENASE
    3e-11  34%  1e3sA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    3e-11  22%  3ctmA  [x.x.x] CARBONYL REDUCTASE
    4e-11  32%  1uayB  [c.2.1] TYPE II 3-HYDROXYACYL-COA DEHYDROGENASE
    4e-11  25%  1gcoA  [c.2.1] GLUCOSE DEHYDROGENASE
    5e-11  31%  1uayA  [c.2.1] TYPE II 3-HYDROXYACYL-COA DEHYDROGENASE
    5e-11  31%  2qhxC  [x.x.x] PTERIDINE REDUCTASE 1
    5e-11  30%  3dijA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    7e-11  31%  1uluA  [c.2.1] ENOYL-ACYL CARRIER PROTEIN REDUCTASE
    9e-11  28%  1zmoA  [x.x.x] HALOHYDRIN DEHALOGENASE
    9e-11  27%  2jjyC  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    9e-11  27%  2jjyB  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    1e-10  27%  3ctmF  [x.x.x] CARBONYL REDUCTASE
    2e-10  28%  2jjyA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-10  30%  2bf7C  [x.x.x] PTERIDINE REDUCTASE 1
    2e-10  34%  2o23B  [x.x.x] HADH2 PROTEIN
    2e-10  34%  2o23A  [x.x.x] HADH2 PROTEIN
    2e-10  28%  1mxhA  [c.2.1] PTERIDINE REDUCTASE 2
    2e-10  32%  1e7wB  [c.2.1] PTERIDINE REDUCTASE
    2e-10  31%  2b37B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    4e-10  29%  3ek2C  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    4e-10  27%  3ctmH  [x.x.x] CARBONYL REDUCTASE
    5e-10  27%  3ctmD  [x.x.x] CARBONYL REDUCTASE
    5e-10  27%  3ctmB  [x.x.x] CARBONYL REDUCTASE
    6e-10  31%  1zbqA  [x.x.x] 17-BETA-HYDROXYSTEROID DEHYDROGENASE 4
    6e-10  30%  1uluD  [c.2.1] ENOYL-ACYL CARRIER PROTEIN REDUCTASE
    6e-10  45%  2p8kH  [x.x.x] PTERIDINE REDUCTASE 1
    6e-10  26%  2jjyD  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    6e-10  29%  2fwmX  [x.x.x] 2,3-DIHYDRO-2,3-DIHYDROXYBENZOATE DEHYDROGENASE
    6e-10  30%  3ek2A  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    8e-10  31%  2yw9H  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    8e-10  32%  2p8kC  [x.x.x] PTERIDINE REDUCTASE 1
    8e-10  31%  2bfmC  [x.x.x] PTERIDINE REDUCTASE 1
    8e-10  30%  2bf7B  [x.x.x] PTERIDINE REDUCTASE 1
    1e-09  30%  1uluC  [c.2.1] ENOYL-ACYL CARRIER PROTEIN REDUCTASE
    1e-09  23%  3ctmE  [x.x.x] CARBONYL REDUCTASE
    1e-09  30%  1w0cG  [c.2.1] PTERIDINE REDUCTASE
    1e-09  30%  2qhxA  [x.x.x] PTERIDINE REDUCTASE 1
    1e-09  30%  3ek2D  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    1e-09  23%  3ctmC  [x.x.x] CARBONYL REDUCTASE
    1e-09  31%  2bfoC  [x.x.x] PTERIDINE REDUCTASE 1
    1e-09  31%  2bf7D  [x.x.x] PTERIDINE REDUCTASE 1
    2e-09  31%  2qhxD  [x.x.x] PTERIDINE REDUCTASE 1
    2e-09  29%  1e7wA  [c.2.1] PTERIDINE REDUCTASE
    2e-09  31%  2bfaC  [x.x.x] PTERIDINE REDUCTASE 1
    2e-09  31%  2p8kG  [x.x.x] PTERIDINE REDUCTASE 1
    2e-09  31%  2p8kD  [x.x.x] PTERIDINE REDUCTASE 1
    2e-09  30%  3ek2B  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    2e-09  30%  1e92B  [c.2.1] PTERIDINE REDUCTASE 1
    2e-09  30%  2bfaD  [x.x.x] PTERIDINE REDUCTASE 1
    3e-09  30%  2yw9B  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    3e-09  25%  1lxcA  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-09  30%  1e92D  [c.2.1] PTERIDINE REDUCTASE 1
    3e-09  30%  1e92C  [c.2.1] PTERIDINE REDUCTASE 1
    3e-09  22%  3ctmG  [x.x.x] CARBONYL REDUCTASE
    4e-09  30%  2bfpD  [x.x.x] PTERIDINE REDUCTASE 1
    4e-09  31%  2b35B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    5e-09  30%  1w0cH  [c.2.1] PTERIDINE REDUCTASE
    5e-09  41%  1w0cC  [c.2.1] PTERIDINE REDUCTASE
    5e-09  30%  2bfpB  [x.x.x] PTERIDINE REDUCTASE 1
    5e-09  30%  2bfaB  [x.x.x] PTERIDINE REDUCTASE 1
    5e-09  30%  2bfaA  [x.x.x] PTERIDINE REDUCTASE 1
    5e-09  30%  2bf7A  [x.x.x] PTERIDINE REDUCTASE 1
    7e-09  39%  1w0cF  [c.2.1] PTERIDINE REDUCTASE
    7e-09  39%  1w0cE  [c.2.1] PTERIDINE REDUCTASE
    7e-09  39%  1w0cB  [c.2.1] PTERIDINE REDUCTASE
    7e-09  39%  1w0cA  [c.2.1] PTERIDINE REDUCTASE
    7e-09  39%  2p8kB  [x.x.x] PTERIDINE REDUCTASE 1
    7e-09  39%  2p8kA  [x.x.x] PTERIDINE REDUCTASE 1
    7e-09  29%  2gdzA  [x.x.x] NAD+-DEPENDENT 15-HYDROXYPROSTAGLANDIN
    7e-09  39%  1e92A  [c.2.1] PTERIDINE REDUCTASE 1
    7e-09  39%  2bfoA  [x.x.x] PTERIDINE REDUCTASE 1
    7e-09  39%  2bfmB  [x.x.x] PTERIDINE REDUCTASE 1
    9e-09  40%  2o2sA  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    9e-09  31%  1fk8A  [c.2.1] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL
    9e-09  23%  1dfiA  [c.2.1] ENOYL ACYL CARRIER PROTEIN REDUCTASE
    9e-09  27%  1bdbA  [x.x.x] CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE
    9e-09  30%  2b35F  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    9e-09  31%  2b35D  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    9e-09  31%  2b35C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-08  31%  2yw9D  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    1e-08  25%  1i30A  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-08  31%  3fnfB  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-08  32%  2yw9F  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    2e-08  24%  1qsgG  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-08  24%  1qsgA  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    2e-08  24%  1qg6A  [c.2.1] PROTEIN (ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE)
    2e-08  26%  1hxhA  [c.2.1] 3BETA/17BETA-HYDROXYSTEROID DEHYDROGENASE
    2e-08  25%  2fhsB  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE, NADH-
    2e-08  26%  2ehdB  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    2e-08  24%  1c14A  [c.2.1] ENOYL REDUCTASE
    3e-08  32%  2yw9E  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    3e-08  32%  2yw9A  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    3e-08  27%  1yb1A  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE XI
    3e-08  30%  1gz6A  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 4
    3e-08  28%  2aqiA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-08  28%  2h7iA  [c.2.1 (1bvrA)] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-08  29%  1gz6C  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 4
    3e-08  29%  1gz6B  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 4
    3e-08  29%  1fduC  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    3e-08  28%  1enyA  [x.x.x] ENOYL-ACYL CARRIER PROTEIN (ACP) REDUCTASE
    3e-08  29%  1bhsA  [c.2.1 (1dhtA)] 17BETA-HYDROXYSTEROID DEHYDROGENASE
    3e-08  29%  2b36B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-08  31%  2b35A  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-08  28%  2aqhA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-08  28%  2aq8A  [x.x.x] ENOYL-ACYL-CARRIER-PROTEIN REDUCTASE
    3e-08  29%  1a27A  [c.2.1 (1i5rA)] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    4e-08  32%  2yw9C  [x.x.x] ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
    4e-08  27%  2p91A  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    4e-08  29%  1iolA  [x.x.x] ESTROGENIC 17-BETA HYDROXYSTEROID DEHYDROGENASE
    4e-08  31%  3fneB  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    4e-08  25%  2ehdA  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    4e-08  31%  2b35E  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    6e-08  28%  2p91B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    6e-08  27%  1fdvB  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    6e-08  35%  2dknB  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    7e-08  28%  2nv6A  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH
    7e-08  28%  2aqkA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-07  31%  3fnfD  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-07  29%  2b37C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-07  30%  2p91D  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-07  24%  1lx6A  [c.2.1] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-07  31%  3fneD  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-07  31%  1fjhA  [c.2.1] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL
    3e-07  31%  3fnfC  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-07  28%  3fneC  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    4e-07  40%  2o2sB  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    4e-07  27%  1fduD  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    4e-07  27%  1fduB  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    4e-07  27%  1fduA  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    4e-07  30%  1fdsA  [x.x.x] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    5e-07  27%  1yb1B  [c.2.1] 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE XI
    1e-06  27%  1qyxA  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 1
    1e-06  27%  1qyvA  [c.2.1] ESTRADIOL 17 BETA-DEHYDROGENASE 1
    1e-06  27%  1jtvA  [c.2.1] 17 BETA-HYDROXYSTEROID DEHYDROGENASE TYPE 1
    1e-06  27%  1fdwA  [x.x.x] 17-BETA-HYDROXYSTEROID DEHYDROGENASE
    1e-06  27%  3deyX  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 1
    2e-06  28%  2p91C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-06  34%  2ntvA  [x.x.x] ENOYL-[ACP] REDUCTASE
    2e-06  22%  2japC  [x.x.x] CLAVALDEHYDE DEHYDROGENASE
    2e-06  22%  2japA  [x.x.x] CLAVALDEHYDE DEHYDROGENASE
    2e-06  31%  3edmB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-06  31%  3edmA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-06  28%  1uh5A  [c.2.1] ENOYL-ACP REDUCTASE
    2e-06  30%  2op0B  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    2e-06  28%  2oosB  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    2e-06  30%  2oosA  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    2e-06  28%  2ol4B  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    2e-06  32%  2ol4A  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    2e-06  35%  1enoA  [x.x.x] ENOYL ACYL CARRIER PROTEIN REDUCTASE
    2e-06  35%  1d7oA  [c.2.1] ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE (NADH)
    2e-06  35%  1cwuA  [c.2.1] ENOYL ACP REDUCTASE
    3e-06  32%  1vrwA  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    4e-06  25%  2pd3A  [c.2.1 (1jvfA)] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    4e-06  28%  2o2yD  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    5e-06  29%  1zxlA  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    5e-06  29%  1zsnA  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    5e-06  29%  2o2yC  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    5e-06  29%  2o2yA  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    7e-06  47%  1so8A  [c.2.1] 3-HYDROXYACYL-COA DEHYDROGENASE TYPE II
    9e-06  26%  3gy0A  [x.x.x] DEHYDROGENASE
    1e-05  28%  3f5sB  [x.x.x] DEHYDROGENASE
    1e-05  28%  3f5sA  [x.x.x] DEHYDROGENASE
    2e-05  37%  2o50A  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    2e-05  23%  2jahC  [x.x.x] CLAVULANIC ACID DEHYDROGENASE
    2e-05  23%  2jahA  [x.x.x] CLAVULANIC ACID DEHYDROGENASE
    2e-05  23%  2qq5A  [x.x.x] DEHYDROGENASE/REDUCTASE SDR FAMILY MEMBER 1
    2e-05  24%  3g1tA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-05  27%  3f1lB  [x.x.x] UNCHARACTERIZED OXIDOREDUCTASE YCIK
    2e-05  27%  3f1lA  [x.x.x] UNCHARACTERIZED OXIDOREDUCTASE YCIK
    3e-05  37%  2o50B  [x.x.x] ENOYL-ACYL CARRIER REDUCTASE
    3e-05  26%  3k2eA  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
    3e-05  24%  3grkD  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    3e-05  24%  3grkA  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    4e-05  26%  3gz4B  [x.x.x] HYPOTHETICAL OXIDOREDUCTASE YCIK
    4e-05  26%  3gz4A  [x.x.x] HYPOTHETICAL OXIDOREDUCTASE YCIK
    6e-05  35%  3e9nA  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    6e-05  21%  2bd0A  [x.x.x] SEPIAPTERIN REDUCTASE
    8e-05  24%  3guyH  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    8e-05  24%  3guyG  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    8e-05  24%  3guyD  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    8e-05  24%  3guyC  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    1e-04  24%  3grkB  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    1e-04  27%  3f5qB  [x.x.x] DEHYGROGENASE
    1e-04  27%  3f5qA  [x.x.x] DEHYGROGENASE
    4e-04  24%  3grkG  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    4e-04  38%  3e9nC  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    6e-04  26%  3k2eB  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
    6e-04  24%  3guyA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
:235

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSNRIVLITGATKRIGLATSLYLNNQGWQVIGIARSYIDNFPGELFLCDLANEEQTASTLIQINEIHGCP
2zk7B           LRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPGEAKYDHIECDVTNPDQVKASIDHIFKEYGSI
2dteA           LRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPGEAKYDHIECDVTNPDQVKASIDHIFKEYGSI
1i01E           ---KIALVTGASRGIGRAIAETLAARGAKVIGTATSEISDYNGKGLMLNVTDPASIESVLEKIRAEFGEV
1q7bA           ---KIALVTGASRGIGRAIAETLAARGAKVIGTATSEISDYNGKGLMLNVTDPASIESVLEKIRAEFGEV
1q7cA           ---KIALVTGASRGIGRAIAETLAARGAKVIGTATSEISDYNGKGLMLNVTDPASIESVLEKIRAEFGEV
1q7bB           ---KIALVTGASRGIGRAIAETLAARGAKVIGTATSEISDYNGKGLMLNVTDPASIESVLEKIRAEFGEV
1uznA           --SRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRG--SGAPKGLFEVDVTDSDAVDRAFTAVEEHQGPV
2zk7A           LRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPGEAKYDHIECDVTNPDQVKASIDHIFKEYGSI
1i01B           ---KIALVTGASRGIGRAIAETLAARGAKVIGTATSEISDYNGKGLMLNVTDPASIESVLEKIRAEFGEV
2uvdA           LKGKVALVTGASRGIGRAIAIDLAKQGANVVQKANEVVDEIKAIAVRADVANAEDVTNMVKQTVDVFGQV
2hq1A           LKGKTAIVTGSSRGLGKAIAWKLGNMGANIV------LNGSPASTSLDATAEEFKAANVVVAKGDVKN-P
2p68A           LQGKVSLVTGSTRGIGRAIAEKLASAGSTVIEIANKYGVKAHGVEM--NLLSEESINKAFEEIYNLVDGI
1i01A           ---KIALVTGASRGIGRAIAETLAARGAKVIGTATSEISDYNGKGLMLNVTDPASIESVLEKIRAEFGEV
1uzlA           --SRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRG--SGAPKGLFECDVTDSDAVDRAFTAVEEHQGPV
1i01F           ---KIALVTGASRGIGRAIAETLAARGAKVIGTATSEISDYNGKGLMLNVTDPASIESVLEKIRAEFGEV
1uzlB           --SRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRG--SGAPKGLFECDVTDSDAVDRAFTAVEEHQGPV
2ph3A           -------------------------------------------------------------QAAEVLGGL
1i01G           ---KIALVTGASRGIGRAIAETLAARGAKVIGTATSEISDYNGKGLMLNVTDPASIESVLEKIRAEFGEV
1iy8A           -TDRVVLITGGGSGLGRATAVRLAAEGAKLSGLEASVLETAPDAEVLADVSDEAQVEAYVTATTERFGRI
2c07A           --NKVALVTGAGRGIGREIAKMLAKSVSHVICISRSVVDEYESSGYAGDVSKKEEISEVINKILTEHKNV
1uznB           --SRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRG--SGAPKGLFEVDVTDSDAVDRAFTAVEEHQGPV
1i01H           ---KIALVTGASRGIGRAIAETLAARGAKVIGTATSEISDYNGKGLMLNVTDPASIESVLEKIRAEFGEV
3gk3B           -AKRVAFVTGGMGGLGAAISRRLHDAG---MAVAVSHSDHVSTWLYAVDVADFESCERCAEKVLADFGKV
1i01C           ---KIALVTGASRGIGRAIAETLAARGAKVIGTATSEISDYLGANGKGLMLNVTSIESVLEKIRAEFGEV
3f9iA           LTGKTSLITGASSGIGSAIARLLHKLGSKVISLGNALKDNYTIEV--CNLANKEECSNLISKTSNL----
1uzmA           --SRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRG--SGAPKGLFEVDVTDSDAVDRAFTAVEEHQGPV
1o5iA           -----VLVLAASRGIGRAVADVLSQEGAEVTICARNLLKRSGHRYVVCDLRKDLDLLFE--KVKEV----
1i01D           ---KIALVTGASRGIGRAIAETLAARGAKVIGTATSEISDYNGKGLMLNVTDPASIESVLEKIRAEFGEV
3gk3D           -AKRVAFVTGGMGGLGAAISRRLHDAG-MAVAVSHSVSTWLMHEAYAVDVADFESCERCAEKVLADFGKV
1gegE           ---KVALVTGAGQGIGKAIALRLVKDGFAVAKAVASEINQAGGHAVAVDVSDRDQVFAAVEQARKTLGGF
1gegA           ---KVALVTGAGQGIGKAIALRLVKDGFAVAKAVASEINQAGGHAVAVDVSDRDQVFAAVEQARKTLGGF
3f9iB           LTGKTSLITGASSGIGSAIARLLHKLGSKVISLGNALKDNYTIEV--CNLANKEECSNLISKTSNL----
3gk3A           -AKRVAFVTGGMGGLGAAISRRLHDAGMAVAVSHSERNDHVSTWLYAVDVADFESCERCAEKVLADFGKV
2nm0A           --SRSVLVTGGNRGIGLAIARAFADAGDKV---AITYRSGEPPEGFLCDITDTEQVEQAYKEIEETHGPV
3gk3C           -AKRVAFVTGGMGGLGAAISRRLHDAGMAVAVSHSERNDHVSTWLYAVDVADFESCERCAEKVLADFGKV
2ntnA           --SRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRG--SGAPKGLFEVDVTDSDAVDRAFTAVEEHQGPV
1edoA           ----VVVVTGASRGIGKAIALSLGKAGCKVVNYARSQIEAYGGQAFGGDVSKEADVEAMMKTAIDAWGTI
2ae2A           ------LVTGGSRGIGYGIVEELASLGASVYTCSRNQKEGFKVEASVCDLSSRSERQELMNTVNHFHGKL
1zemA           -NGKVCLVTGAGGNIGLATALRLAEEGTAILDMNREALEKAEASVYVCDVTSEEAVIGTVDSVVRDFGKI
2p68B           LQGKVSLVTGSTRGIGRAIAEKLASAGSTVIEIANKYGVKAHGVEM--NLLSEESINKAFEEIYNLVDGI
2c7vB           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVQADRAFGRC
2d1yC           -------------------------------------------------------------------GRV
2c7vA           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVQADRAFGRC
1vl8B           LRGRVALVTGGSRGLGFGIAQGLAEAGCSVVVASRNLEEASEAAAFRCDVSNYXXXXXXXXXXXXXFGKL
1vl8A           LRGRVALVTGGSRGLGFGIAQGLAEAGCSVVVASRNLEEASEAAAFRCDVSNYXXXXXXXXXXXXXFGKL
2d1yD           -------------------------------------------------------------------GRV
2d1yB           -------------------------------------------------------------------GRV
2d1yA           -------------------------------------------------------------------GRV
2c7vD           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVQADRAFGRC
1ae1B           ------LVTGGSKGIGYAIVEELAGLGARVYTCSRNEKENVEGSV--CDLLSRTERDKLMQTVAHVFGKL
3ftpA           LDKQVAIVTGASRGIGRAIALELARRGAMVXXXXXXXXXXXXXXXXFKQAGLEGRGA--VLNVNDAFGAL
1xr3B           --SEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGGVEADGRTCDVRSVPEIEALVAAVVERYGPV
3bmqA           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
3imfA           ----------------------------------------FPGQILTVQDVRNTDDIQKIEQIDEKFGRI
2ae1A           ------LVTGGSRGIGYGIVEELASLGASVYTCSRNQKEGFKVEASVCDLSSRSERQELMNTVNHFHGKL
2ph3B           -------------------------------------------------------------QAAEVLGGL
3bmeC           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVQADRAFGRC
2rhrB           --SEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGGVEADGRTCDVRSVPEIEALVAAVVERYGPV
3imfB           ----------------------------------------FPGQILTVQDVRNTDDIQKIEQIDEKFGRI
3i3oF           LKGKNVLITGGDSGIGRAVSIAFAKEG---ANIAIAYLDELPGDL------SDEQHCKDIVQVRQL-GSL
3i3oE           LKGKNVLITGGDSGIGRAVSIAFAKEG---ANIAIAYLDELPGDL------SDEQHCKDIVQVRQL-GSL
3i3oC           LKGKNVLITGGDSGIGRAVSIAFAKEG---ANIAIAYLDELPGDL------SDEQHCKDIVQVRQL-GSL
3i3oB           LKGKNVLITGGDSGIGRAVSIAFAKEG---ANIAIAYLDELPGDL------SDEQHCKDIVQVRQL-GSL
3i3oA           LKGKNVLITGGDSGIGRAVSIAFAKEG---ANIAIAYLDELPGDL------SDEQHCKDIVQVRQL-GSL
3csdB           --SEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGGVEADGRTCDVRSVPEIEALVAAVVERYGPV
2ntnB           --SRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRG--SGAPKGLFEVDVTDSDAVDRAFTAVEEHQGPV
3ftpC           LDKQVAIVTGASRGIGRAIALELARRGAMVXXXXXXXXXXXXXXXXFKQAGLEGRGA--VLNVNDAFGAL
3bmeA           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVQADRAFGRC
2c7vC           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVQADRAFGRC
1x7gB           --SEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGGVEADGRTCDVRSVPEIEALVAAVVERYGPV
1w4zB           --SEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGGVEADGRTCDVRSVPEIEALVAAVVERYGPV
1ulsB           LKDKAVLITGAAHGIGRATLELFAKEGARLVACD---IEEGPGAHPVVDVADPASVERGFAEALAHLGRL
1ulsA           LKDKAVLITGAAHGIGRATLELFAKEGARLVACD---IEEGPGAHPVVDVADPASVERGFAEALAHLGRL
3i3oH           LKGKNVLITGGDSGIGRAVSIAFAKEG---ANIAIAYLDELPGDL------SDEQHCKDIVQVRQL-GSL
3bmfC           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
3bmeB           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVQADRAFGRC
1xkqB           -SNKTVIITGSSNGIGRTTAILFAQEGANVTGVSEKQVNSVVADVTTED-GQDQIINSTLKQFGKI----
1xkqA           -SNKTVIITGSSNGIGRTTAILFAQEGANVTGVSEKQVNSVVADVTTED-GQDQIINSTLKQFGKI----
3d3wA           LAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADECPGIEPVCDLGDWEATERALGSVGPV----
3bmnD           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
1uzmB           --SRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRG--SGAPKGLFEVDVTDSDAVDRAFTAVEEHQGPV
3bmoB           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
3bmjD           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
3bmfB           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
2wd7B           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVQADRAFGRC
3ftpD           LDKQVAIVTGASRGIGRAIALELARRGAMVXXXXXXXXXXXXXXXXFKQAGLEGRGA--VLNVNDAFGAL
1fmcA           -------------------------------------IQQLGGQAFACDITSEQELSALADFAISKLGKV
3cxtA           LKGKIALVTGASYGIGFAIASAYAKAGATIVGMAAYKAAGINAHGYVCDVTDEDGIQAMVAQIESEVGII
1ahhA           -------------------------------------IQQLGGQAFACDITSEQELSALADFAISKLGKV
1xg5C           --DRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNGYPGTLYRCDLSNEEDILSMFSAIRSQHSGV
1x7hB           --SEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGGVEADGRTCDVRSVPEIEALVAAVVERYGPV
1x7gA           --SEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGGVEADGRTCDVRSVPEIEALVAAVVERYGPV
1w4zA           --SEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGGVEADGRTCDVRSVPEIEALVAAVVERYGPV
2rhrA           --SEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGGVEADGRTCDVRSVPEIEALVAAVVERYGPV
2rh4B           --SEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGGVEADGRTCDVRSVPEIEALVAAVVERYGPV
2rh4A           --SEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGGVEADGRTCDVRSVPEIEALVAAVVERYGPV
3cxrA           LKGKIALVTGASYGIGFAIASAYAKAGATIVGMAAYKAAGINAHGYVCDVTDEDGIQAMVAQIESEVGII
1ae1A           ------LVTGGSKGIGYAIVEELAGLGARVYTCSRNEKENVEGSV--CDLLSRTERDKLMQTVAHVFGKL
2z1nB           IQGKLAVVTAGSSGLGFASALELARNGARLLLFSRSLVSGAQVDIVAGDIREPGDIDRLFEKARDLGGA-
3bmfD           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
2wd7C           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVQADRAFGRC
3bmnA           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
2z1nA           IQGKLAVVTAGSSGLGFASALELARNGARLLLFSRSLVSGAQVDIVAGDIREPGDIDRLFEKARDLGGA-
3grpA           ----------------------------------------------------------------------
1yxmD           LQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRSAADELQANLIQCNIRNEEEVNNLVKSTLDTFGKI
2pd6D           LRSALALVTGAGSGIGRAVSVRLAGEGATVAACAQETVRLLNHAAFQADVS-EARAARCLLE--QVQACP
3imfC           ----------------------------------------FPGQILTVQDVRNTDDIQKIEQIDEKFGRI
3bmnC           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
2pd6C           ----LALVTGAGSGIGRAVSVRLAGEGATVAACAQETVRLLNHAAFQADVS-EARAARCLLE--QVQACP
3bmoC           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
3bmoD           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
3bmkC           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
2yz7A           LKGKKAVVTGSTSGIGLAMATELAKAGADVVGFGRSTLESKFGVYLNADLSDAQATRDFIAKAAEALGGL
2vz0B           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
1ulsC           LKDKAVLITGAAHGIGRATLELFAKEGARLVACD---IEEGPGAHPVVDVADPASVERGFAEALAHLGRL
3bmoA           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
3bmnB           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
3bmdB           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
3ezlA           ----------------------------------------------------------------------
3emkA           LTGRKALVTGATGGLGEAIARALHAQG-AIVGLHGTXXXXXXGEVFPANLSDREAVKALGQKAEEEMGGV
1cydA           ------LVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDECPGIEPVCDLGDWDATEKALGGIGPV----
1yxmA           LQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRSAADELQANLIQCNIRNEEEVNNLVKSTLDTFGKI
1pr9A           LAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADECPGIEPVCDLGDWEATERALGSVGPV----
2pd6B           LRSALALVTGAGSGIGRAVSVRLAGEGATV---AACDLDRAAAQETVRLLGNEARAARCLLE--QVQACP
3ennA           LTGRKALVTGATGGLGEAIARALHAQG-AIVGLHGTXXXXXXGEVFPANLSDREAVKALGQKAEEEMGGV
1xg5A           --DRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNGYPGTLYRCDLSNEEDILSMFSAIRSQHSGV
2vz0A           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
3ennB           LTGRKALVTGATGGLGEAIARALHAQG-AIVGLHGTXXXXXXGEVFPANLSDREAVKALGQKAEEEMGGV
3bmiB           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
3bmfA           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
2ag5C           ----------------------------------------------------------------------
2ag5B           ----------------------------------------------------------------------
2ag5A           ----------------------------------------------------------------------
3i3oG           LKGKNVLITGGDSGIGRAVSIAFAKEG---ANIAIAYLDELPGDL------SDEQHCKDIVQVRQL-GSL
1yxmB           LQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRSAADELQANLIQCNIRNEEEVNNLVKSTLDTFGKI
3bmqC           ------VVTGAAKRIGRAIAVKLHQTGYRVV---IHYHNSAEAAVSLADELNKERSNTAVVSCEEIFGRC
2ztmC           ----------------------------------------------------------------------
1xg5B           --DRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNGYPGTLYRCDLSNEEDILSMFSAIRSQHSGV
3emkD           LTGRKALVTGATGGLGEAIARALHAQG-AIVGLHGTXXXXXXGEVFPANLSDREAVKALGQKAEEEMGGV
2ztvC           ----------------------------------------------------------------------
2ztvB           ----------------------------------------------------------------------
2pd6A           LRSALALVTGAGSGIGRAVSVRLAGEGATVAACAQETVRLLNHAAFQADVS-EARAARCLLE--QVQACP
3ennD           LTGRKALVTGATGGLGEAIARALHAQG-AIVGLHGTXXXXXXGEVFPANLSDREAVKALGQKAEEEMGGV
3ennC           LTGRKALVTGATGGLGEAIARALHAQG-AIVGLHGTXXXXXXGEVFPANLSDREAVKALGQKAEEEMGGV
2q2vD           LKGKTALVTGSTSGIGLGIAQVLARAGANIV--LNGFGDPAPALAEIADLSDVAQIEALFALAEREFGGV
3emkC           LTGRKALVTGATGGLGEAIARALHAQG-AIVGLHGTXXXXXXGEVFPANLSDREAVKALGQKAEEEMGGV
1hdcA           ------------------------------------------------DVTIEEDWQRVVAYAREEFGSV
3emkB           LTGRKALVTGATGGLGEAIARALHAQG-AIVGLGTRELKELAAELFPANLSDREAVKALGQKAEEEMGGV
2cfcA           --SRVAIVTGASSGNGLAIATRFLARGDRVAALARTHWHAYADKVLRADVADEGDVNAAIAATMEQFGAI
2a4kA           LSGKTILVTGAASGIGRAALDLFAREGASLVAVDREXXXXXXXXXXXXDVSDPKXXXXXXXXXXXXXGRL
2ztvD           ----------------------------------------------------------------------
2q2wD           LKGKTALVTGSTSGIGLGIAQVLARAGANIV--LNGFGDPAPALAEIADLSDVAQIEALFALAEREFGGV
2q2vC           LKGKTALVTGSTSGIGLGIAQVLARAGANIV--LNGFGDPAPALAEIADLSDVAQIEALFALAEREFGGV
3ijrH           LKGKNVLITGGDSGIGRAVSIAFAKEG---ANIAIAYLDELPGDL------SDEQHCKDIVQVRQL-GSL
3ijrF           LKGKNVLITGGDSGIGRAVSIAFAKEG---ANIAIAYLDELPGDL------SDEQHCKDIVQVRQL-GSL
3ijrE           LKGKNVLITGGDSGIGRAVSIAFAKEG---ANIAIAYLDELPGDL------SDEQHCKDIVQVRQL-GSL
3ijrB           LKGKNVLITGGDSGIGRAVSIAFAKEG---ANIAIAYLDELPGDL------SDEQHCKDIVQVRQL-GSL
3ijrA           LKGKNVLITGGDSGIGRAVSIAFAKEG---ANIAIAYLDELPGDL------SDEQHCKDIVQVRQL-GSL
3gafD           -----------------------------------------------CNVTDEQHREAVIKAALDQFGKI
3gafA           -----------------------------------------------CNVTDEQHREAVIKAALDQFGKI
2q2wC           LKGKTALVTGSTSGIGLGIAQVLARAGANIV--LNGFGDPAPALAEIADLSDVAQIEALFALAEREFGGV
2zatA           LENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQVATLQGEGLVCHVGKAEDRERLVAMAVNLHGGV
2q2qC           LKGKTALVTGSTSGIGLGIAQVLARAGANIV--LNGFGDPAPALAEIADLSDVAQIEALFALAEREFGGV
2q2qA           LKGKTALVTGSTSGIGLGIAQVLARAGANIV--LNGFGDPAPALAEIADLSDVAQIEALFALAEREFGGV
3gafF           -----------------------------------------------CNVTDEQHREAVIKAALDQFGKI
1w6uC           -----------------------------------------------CDVRDPDMVQNTVSELIKVAGHP
1spxA           -AEKVAIITGSSNGIGRATAVLFAREGAKVTGVSEQNVNSVVADV-TTDAGQDEILSTTLGKFGKL----
1ybvA           LEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEGSDAACVKANVEDIVRMFEEAVKIFGKL
1w6uB           -----------------------------------------------CDVRDPDMVQNTVSELIKVAGHP
2q2vB           LKGKTALVTGSTSGIGLGIAQVLARAGANIV--LNGFGDPAPALAEIADLSDVAQIEALFALAEREFGGV
2q2qG           LKGKTALVTGSTSGIGLGIAQVLARAGANIV--LNGFGDPAPALAEIADLSDVAQIEALFALAEREFGGV
2q2qE           LKGKTALVTGSTSGIGLGIAQVLARAGANIV--LNGFGDPAPALAEIADLSDVAQIEALFALAEREFGGV
3gafG           -----------------------------------------------CNVTDEQHREAVIKAALDQFGKI
3gafE           -----------------------------------------------CNVTDEQHREAVIKAALDQFGKI
3gafC           -----------------------------------------------CNVTDEQHREAVIKAALDQFGKI
3gafB           -----------------------------------------------CNVTDEQHREAVIKAALDQFGKI
1g0oC           LEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEGSDAACVKANVEDIVRMFEEAVKIFGKL
1g0oA           LEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEGSDAACVKANVEDIVRMFEEAVKIFGKL
1dohB           LEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEGSDAACVKANVEDIVRMFEEAVKIFGKL
1dohA           LEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEGSDAACVKANVEDIVRMFEEAVKIFGKL
2ztmD           ----------------------------------------------------------------------
2ztlA           ----------------------------------------------------------------------
1w6uA           -----------------------------------------------CDVRDPDMVQNTVSELIKVAGHP
3grpB           ----------------------------------------------------------------------
2q2qB           LKGKTALVTGSTSGIGLGIAQVLARAGANIV--LNGFGDPAPALAEIADLSDVAQIEALFALAEREFGGV
1h5qA           --NKTIIVTGGNRGIGLAFTRXXXXXXXXXXXIYRSAADGVKTKAYQCDVSNTDIVTKTIQQIDADLGPI
3gafH           -----------------------------------------------CNVTDEQHREAVIKAALDQFGKI
1g0nB           LEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEGSDAACVKANVEDIVRMFEEAVKIFGKL
2q2wA           LKGKTALVTGSTSGIGLGIAQVLARAGANIV--LNGFGDPAPALAEIADLSDVAQIEALFALAEREFGGV
2ztmA           ----------------------------------------------------------------------
2q2qF           LKGKTALVTGSTSGIGLGIAQVLARAGANIV--LNGFGDPAPALAEIADLSDVAQIEALFALAEREFGGV
2b4qA           LAGRIALVTGGSRGIGQMIAQGLLEAGARVFICARAYGDC---QAIPADLSSEAGARRLAQALGELSARL
2q2vA           LKGKTALVTGSTSGIGLGIAQVLARAGANIV--LNGFGDPAPALAEIADLSDVAQIEALFALAEREFGGV
2q2qH           LKGKTALVTGSTSGIGLGIAQVLARAGANIV--LNGFGDPAPALAEIADLSDVAQIEALFALAEREFGGV
2ztuD           ----------------------------------------------------------------------
2ztmB           ----------------------------------------------------------------------
1x1tA           ----------------------------------------------------------------------
1w6uD           -----------------------------------------------CDVRDPDMVQNTVSELIKVAGHP
2ztuC           ----------------------------------------------------------------------
3grpC           ----------------------------------------------------------------------
1yxmC           LQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLLKSAADEL----QANLKQARVIPIQCNIRN---
1x1eA           ----------------------------------------------------------------------
2ekpA           ----------------------------------------------------------------------
1xhlA           -SGKSVIITGSSNGIGRSAAVIFAKEGAQVTITGRNELEETKQQILKAGVPAEKINA-VVADVTEASGQD
2ekqD           ----------------------------------------------------------------------
2ztuB           ----------------------------------------------------------------------
1ydeP           ----------------------------------RALEQELPGAVFLCDVTQEDDVKTLVSETIRRFGRL
1ydeN           ----------------------------------RALEQELPGAVFLCDVTQEDDVKTLVSETIRRFGRL
1ydeM           ----------------------------------RALEQELPGAVFLCDVTQEDDVKTLVSETIRRFGRL
1ydeI           ----------------------------------RALEQELPGAVFLCDVTQEDDVKTLVSETIRRFGRL
1ydeH           ----------------------------------RALEQELPGAVFLCDVTQEDDVKTLVSETIRRFGRL
1ydeG           ----------------------------------RALEQELPGAVFLCDVTQEDDVKTLVSETIRRFGRL
1ydeF           ----------------------------------RALEQELPGAVFLCDVTQEDDVKTLVSETIRRFGRL
1ydeD           ----------------------------------RALEQELPGAVFLCDVTQEDDVKTLVSETIRRFGRL
1ydeB           ----------------------------------RALEQELPGAVFLCDVTQEDDVKTLVSETIRRFGRL
1ydeA           ----------------------------------RALEQELPGAVFLCDVTQEDDVKTLVSETIRRFGRL
3grpD           ----------------------------------------------------------------------
1ja9A           ------------------------------------------GVAIQADISKPSEVVALFDKAVSHFGGL
2ztuA           ----------------------------------------------------------------------
1k2wA           ------------------------------------------------DVTDQASIDRCVAELLDRWGSI
2b4qB           LAGRIALVTGGSRGIGQMIAQGLLEAGARVFICARAYGDC---QAIPADLSSEAGARRLAQALGELSARL
2ewmB           LKDKLAVITGGANGIGRAIAERFAVEGADIAIAAEAAIRNLGRRVLTCDVSQPGDVEAFGKQVISTFGRC
1zjyA           -------------------------------------------QFFQHDSSDEDGWTKLFDATEKAFGPV
1nxqA           -------------------------------------------QFFQHDSSDEDGWTKLFDATEKAFGPV
2ewmA           LKDKLAVITGGANGIGRAIAERFAVEGADIAIAAEAAIRNLGRRVLTCDVSQPGDVEAFGKQVISTFGRC
2bgkA           -----------------------------------------------CDVTKDEDVRNLVDTTIAKHGKL
2ew8A           LKDKLAVITGGANGIGRAIAERFAVEGADIAIAAEAAIRNLGRRVLTCDVSQPGDVEAFGKQVISTFGRC
2ew8B           LKDKLAVITGGANGIGRAIAERFAVEGADIAIAAEAAIRNLGRRVLTCDVSQPGDVEAFGKQVISTFGRC
1e6wA           ----VAVITGGASGLGLSTAKRLVGQGATAVLLD---VPNSEGEIFAANVTSEKEVQAALTLAKEKFGRI
3iccA           LKGKVALVTGASRGIGRAIAKRLANDG-ALVAIHYGNRKEEAEETVYEIQSNGGSAFSIGANLESLHGVE
3i4fC           ---RHALITAGTKGLGKQVTEKLLAKGYSVTTMKETYKDVEERLQFVADVTKKEDLHKIVEEAMSHFGKI
3i4fD           ---RHALITAGTKGLGKQVTEKLLAKGYSVTTMKETYKDVEERLQFVADVTKKEDLHKIVEEAMSHFGKI
3i4fA           ---RHALITAGTKGLGKQVTEKLLAKGYSVTTMKETYKDVEERLQFVADVTKKEDLHKIVEEAMSHFGKI
1e3wA           ----VAVITGGASGLGLSTAKRLVGQGATAVLLD---VPNSEGEIFAANVTSEKEVQAALTLAKEKFGRI
1w73A           -----------------------------------------------CDVRDPD-VQNTVSELIKVAGHP
1nffA           ----------------------------------------------------------------------
3gvcD           ------------------------------------------------DVSDEQQIIAMVDACVAAFGGV
2et6A           --DKVVIITGAGGGLGKYYSLEFAKLGAKVVKAADVVVDEIVGGVAVADYNNVLDGDKIVETAVKNFGTV
1e6wD           ----VAVITGGASGLGLSTAKRLVGQGATAVLLD---VPNSEGEIFAANVTSEKEVQAALTLAKEKFGRI
3gvcC           ------------------------------------------------DVSDEQQIIAMVDACVAAFGGV
3gvcB           ------------------------------------------------DVSDEQQIIAMVDACVAAFGGV
1w73C           -----------------------------------------------CDVRDPD-VQNTVSELIKVAGHP
3gvcA           ------------------------------------------------DVSDEQQIIAMVDACVAAFGGV
1w73D           -----------------------------------------------CDVRDPD-VQNTVSELIKVAGHP
1p33C           ----VALVTGAAKRLGSSIAEALHAEGYTVCXXXXXXXXRRPNSAITADLSNVATASSVLVDACYMHGRC
1p33B           ----VALVTGAAKRLGSSIAEALHAEGYTVCXXXXXXXXRRPNSAITADLSNVATASSVLVDACYMHGRC
1p33A           ----VALVTGAAKRLGSSIAEALHAEGYTVCXXXXXXXXRRPNSAITADLSNVATASSVLVDACYMHGRC
3gedB           ----------------------------------------------------------------------
3gedA           ----------------------------------------------------------------------
1p33D           ----VALVTGAAKRLGSSIAEALHAEGYTVCXXXXXXXXRRPNSAITADLSNVATASSVLVDACYMHGRC
1e6wC           ----VAVITGGASGLGLSTAKRLVGQGATAVLLD---VPNSEGEIFAANVTSEKEVQAALTLAKEKFGRI
2a4kB           ----------------------------------------------------------------------
1xq1A           ---KTVLVTGGTKGIGHAIVEEFAGFGAVIHTCARNEYEGFQVTGSVCDASLRPEREKLMQTVSSMFGGK
1w73B           -----------------------------------------------CDVRDPD-VQNTVSELIKVAGHP
1uluB           ---------------------------------------------FRADVTQDEELDALFAGVKEAFGGL
1e6wB           ----VAVITGGASGLGLSTAKRLVGQGATAVLLD---VPNSEGEIFAANVTSEKEVQAALTLAKEKFGRI
1rwbA           LEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEVGGEAIAVDVTVESDVINLVQSAIKEFGKL
2qioA           ----------------------------------RELADTLEGQESLCDVTNDEELTACFETIKQEVGTI
3gegA           ----------------------------------------------------------------------
2dknA           ----------------------------------------------------------------------
1g6kA           LEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEVGGEAIAVDVTVESDVINLVQSAIKEFGKL
1nfrA           ----------------------------------------------------------------------
1u7tA           ------------------------------------------------DVTSEKDVQTALALAKGKFGRV
3diiA           ----------------------------------------------------------------------
1pwxA           ---------------------------------------------------SEQEPAELIEAVTSAYGQV
1mxfA           ------VITGGARRIGHSIAVRLHQQGFRVVGAAQRLVAELAGSAVLCKXXXXXDCCEDIIDCSRAFGRC
1geeA           LEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEVGGEAIAVDVTVESDVINLVQSAIKEFGKL
1e3sA           ----VAVITGGASGLGLSTAKRLVGQGATAVLLD---VPNSEGEIFAANVTSEKEVQAALTLAKEKFGRI
3ctmA           ---------------------------------------------YKCNISDPKSVEETISQQEKDFGTI
1uayB           ----------------------------------------------------------------------
1gcoA           LEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEVGGEAIAVDVTVESDVINLVQSAIKEFGKL
1uayA           ----------------------------------------------------------------------
2qhxC           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
3dijA           ----------------------------------------------------------------------
1uluA           ---------------------------------------------FRADVTQDEELDALFAGVKEAFGGL
1zmoA           ----IALVTHARHFAGPAAVEALTQDGYTVVCHDASFADAAERQRFESEIALAEQKPERLVDATLQHGAI
2jjyC           LAGKKILITGSNKSIAYGIAKAMHREGAE---LAFTYVGQFPAAVLPCDVISDQEIKDLFVELGKVWDGL
2jjyB           LAGKKILITGSNKSIAYGIAKAMHREGAE---LAFTYVGQFPAAVLPCDVISDQEIKDLFVELGKVWDGL
3ctmF           ---------------------------------------------YKCNISDPKSVEETISQQEKDFGTI
2jjyA           LAGKKILITGSNKSIAYGIAKAMHREGAE---LAFTYVGQFPAAVLPCDVISDQEIKDLFVELGKVWDGL
2bf7C           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
2o23B           ------------------------------------------------DVTSEKDVQTALALAKGKFGRV
2o23A           ------------------------------------------------DVTSEKDVQTALALAKGKFGRV
1mxhA           ------VITGGARRIGHSIAVRLHQQGFRVVGAAQRLVAELAGSAVLCKXXXXXDCCEDIIDCSRAFGRC
1e7wB           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATAPVTLFRCAELWGRC
2b37B           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
3ek2C           --------------------------------------------VFPCDVADDAQIDALFASLKTHWDSL
3ctmH           ---------------------------------------------YKCNISDPKSVEETISQQEKDFGTI
3ctmD           ---------------------------------------------YKCNISDPKSVEETISQQEKDFGTI
3ctmB           ---------------------------------------------YKCNISDPKSVEETISQQEKDFGTI
1zbqA           ----------------------------------------------------------------------
1uluD           ---------------------------------------------FRADVTQDEELDALFAGVKEAFGGL
2p8kH           ----------------------------------------------------------------------
2jjyD           LAGKKILITGSNKSIAYGIAKAMHREGAE---LAFTYVGQFPAAVLPCDVISDQEIKDLFVELGKVWDGL
2fwmX           -SGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQAFTEQYPFATEXXXXXXXXXXXXXCQRLLAETERL
3ek2A           --------------------------------------------VFPCDVADDAQIDALFASLKTHWDSL
2yw9H           ---------------------------------------------FRADVTQDEELDALFAGVKEAFGGL
2p8kC           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATAPSALVAACYTHGRC
2bfmC           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATAAAELVAACYTHGRC
2bf7B           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATAPSALVAACYTHGRC
1uluC           ---------------------------------------------FRADVTQDEELDALFAGVKEAFGGL
3ctmE           ---------------------------------------------YKCNISDPKSVEETISQQEKDFGTI
1w0cG           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
2qhxA           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
3ek2D           --------------------------------------------VFPCDVADDAQIDALFASLKTHWDSL
3ctmC           ---------------------------------------------YKCNISDPKSVEETISQQEKDFGTI
2bfoC           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATAPVTLFRCAELWGRC
2bf7D           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
2qhxD           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
1e7wA           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATAPVSSAPVTLFTRCA
2bfaC           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
2p8kG           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
2p8kD           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
3ek2B           --------------------------------------------VFPCDVADDAQIDALFASLKTHWDSL
1e92B           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATAPSALVAACYTHGRC
2bfaD           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
2yw9B           ---------------------------------------------FRADVTQDEELDALFAGVKEAFGGL
1lxcA           LSGKRILVTGVASKLSIAAELAFTYQNDKLKGRVEEFAAQLGSDIVLCDVAEDASIDTMFAELGKVWPKF
1e92D           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
1e92C           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
3ctmG           ---------------------------------------------YKCNISDPKSVEETISQQEKDFGTI
2bfpD           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
2b35B           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
1w0cH           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
1w0cC           ----------------------------------------------------------------------
2bfpB           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
2bfaB           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
2bfaA           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
2bf7A           ----VALVTGAAKRLGRSIAEGLHAEGYAVCALSATLNARRPNSAITADLSNVATACAELVAACYTHGRC
1w0cF           ----------------------------------------------------------------------
1w0cE           ----------------------------------------------------------------------
1w0cB           ----------------------------------------------------------------------
1w0cA           ----------------------------------------------------------------------
2p8kB           ----------------------------------------------------------------------
2p8kA           ----------------------------------------------------------------------
2gdzA           -----------------------------------------------CDVADQQQLRDTFRKVVDHFGRL
1e92A           ----------------------------------------------------------------------
2bfoA           ----------------------------------------------------------------------
2bfmB           ----------------------------------------------------------------------
2o2sA           ----------------------------------------------------------------------
1fk8A           ----IIVISGCATGIGAATRKVLEAAGHQIVGI-----DIRDAEV-IADLSTAEGRKQAIADV--LAKCS
1dfiA           LSGKRILVTGVASKLSIAAELAFTYQNDKLKGRVEEFAAQLGSDIVLCDVAEDASIDTMFAELGKVWPKF
1bdbA           LKGEAVLITGGASGLGRALVDRFVAEGAKVAVLDKSHGDNVLGIVGVRSLEDQKQAASRCVAR---FGKI
2b35F           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
2b35D           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
2b35C           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
2yw9D           ---------------------------------------------FRADVTQDEELDALFAGVKEAFGGL
1i30A           LSGKRILVTGVASKLSIAAELAFTYQNDKLKGRVEEFAAQLGSDIVLCDVAEDASIDTMFAELGKVWPKF
3fnfB           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
2yw9F           ---------------------------------------------FRADVTQDEELDALFAGVKEAFGGL
1qsgG           LSGKRILVTGVASKLSIAAELAFTYQNDKLKGRVEEFAAQLGSDIVLCDVAEDASIDTMFAELGKVWPKF
1qsgA           LSGKRILVTGVASKLSIAAELAFTYQNDKLKGRVEEFAAQLGSDIVLCDVAEDASIDTMFAELGKVWPKF
1qg6A           LSGKRILVTGVASKLSIAAELAFTYQNDKLKGRVEEFAAQLGSDIVLCDVAEDASIDTMFAELGKVWPKF
1hxhA           ------------------------------------------------DVSSEADWTLVMAAVQRRLGTL
2fhsB           LSGKRILVTGVASKLSIAAELAFTYQNDKLKGRVEEFAAQLGSDIVLCDVAEDASIDTMFAELGKVWPKF
2ehdB           -----VLITGASRGIGEATARLLHAKGYRVGLMARDXXXXXXXXXXXXDVREEGDWARAVAAMEEAFGEL
1c14A           LSGKRILVTGVASKLSIAAELAFTYQNDKLKGRVEEFAAQLGSDIVLCDVAEDASIDTMFAELGKVWPKF
2yw9E           ---------------------------------------------FRADVTQDEELDALFAGVKEAFGGL
2yw9A           ---------------------------------------------FRADVTQDEELDALFAGVKEAFGGL
1yb1A           VTGEIVLITGAGHGIGRLTAYEINKHGLEETA-AKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDV
1gz6A           ----------------------------------------------------------------------
2aqiA           --------------------------GFDRLRLTQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
2h7iA           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
1gz6C           ----------------------------------------------------------------------
1gz6B           ----------------------------------------------------------------------
1fduC           ----VVLITGCSSGIGLHLAVRLASQSFKVYATLRDLKTQGPGSLLQLDVRDSKSVAAARERVTE--GRV
1enyA           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
1bhsA           ----VVLITGCSSGIGLHLAVRLASQSFKVYATLRDLKTQGPGSLLQLDVRDSKSVAAARERVTE--GRV
2b36B           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
2b35A           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
2aqhA           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
2aq8A           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
1a27A           ----VVLITGCSSGIGLHLAVRLASQSFKVYATLRDLKTQGPGSLLQLDVRDSKSVAAARERVTE--GRV
2yw9C           ---------------------------------------------FRADVTQDEELDALFAGVKEAFGGL
2p91A           -----------------------------------------------CDVSLDEDIKNLKKFLEENWGSL
1iolA           ----VVLITGCSSGIGLHLAVRLASQSFKVYATLRDLKTQGPGSLLQLDVRDSKSVAAARERVTE--GRV
3fneB           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
2ehdA           -----VLITGASRGIGEATARLLHAKGYRVGLMARDXXXXXXXXXXXXDVREEGDWARAVAAMEEAFGEL
2b35E           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
2p91B           -----------------------------------------------CDVSLDEDIKNLKKFLEENWGSL
1fdvB           ----VVLITGCSSGIGLHLAVRLASQSFKVYATLRDLKTQGPGSLLQLDVRDSKSVAAARERVTE--GRV
2dknB           ----------------------------------------------------------------------
2nv6A           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
2aqkA           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
3fnfD           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
2b37C           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
2p91D           -----------------------------------------------CDVSLDEDIKNLKKFLEENWGSL
1lx6A           LSGKRILVTGVASKLSIAAELAFTYQNDKLKGRVEEFAAQLGSDIVLCDVAEDASIDTMFAELGKVWPKF
3fneD           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
1fjhA           ----IIVISGCATGIGAATRKVLEAAGHQIVGI-----DIRDAEV-IADLSTAEGRKQAIADV--LAKCS
3fnfC           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
3fneC           --------------------------GFDRLRLIQRITDRLPAKLLELDVQNEEHLASLAGRVTEAIGAG
2o2sB           ----------------------------------------------------------------------
1fduD           ----VVLITGCSSGIGLHLAVRLASQSFKVYATLRDLKTQGPGSLLQLDVRDSKSVAAARERVTE--GRV
1fduB           ----VVLITGCSSGIGLHLAVRLASQSFKVYATLRDLKTQGPGSLLQLDVRDSKSVAAARERVTE--GRV
1fduA           ----VVLITGCSSGIGLHLAVRLASQSFKVYATLRDLKTQGPGSLLQLDVRDSKSVAAARERVTE--GRV
1fdsA           ----VVLITGCSSGIGLHLAVRLASQSFKVYATLRDLKTQGPGSLLQLDVRDSKSVAAARERVTE--GRV
1yb1B           VTGEIVLITGAGHGIGRLTAYEINKHGLEETA-AKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDV
1qyxA           ----VVLITGCSSGIGLHLAVRLASQSFKVYATLRDLKTQGPGSLLQLDVRDSKSVAAARERVTE--GRV
1qyvA           ----VVLITGCSSGIGLHLAVRLASQSFKVYATLRDLKTQGPGSLLQLDVRDSKSVAAARERVTE--GRV
1jtvA           ----VVLITGCSSGIGLHLAVRLASQSFKVYATLRDLKTQGPGSLLQLDVRDSKSVAAARERVTE--GRV
1fdwA           ----VVLITGCSSGIGLHLAVRLASQSFKVYATLRDLKTQGPGSLLQLDVRDSKSVAAARERVTE--GRV
3deyX           ----VVLITGCSSGIGLHLAVRLASQSFKVYATLRDLKTQGPGSLLQLDVRDSKSVAAARERVTE--GRV
2p91C           -----------------------------------------------CDVSLDEDIKNLKKFLEENWGSL
2ntvA           ----------------------------------------------------------------------
2japC           ------------------------------------------------DVADRQGVDAAVASTVEALGGL
2japA           ------------------------------------------------DVADRQGVDAAVASTVEALGGL
3edmB           ----------------------------------------------------------------------
3edmA           ----------------------------------------------------------------------
1uh5A           ----------------------------------------------------------------------
2op0B           ----------------------------------------------------------------------
2oosB           ----------------------------------------------------------------------
2oosA           ----------------------------------------------------------------------
2ol4B           ----------------------------------------------------------------------
2ol4A           ----------------------------------------------------------------------
1enoA           ----------------------------------------------------------------------
1d7oA           ----------------------------------------------------------------------
1cwuA           ----------------------------------------------------------------------
1vrwA           ----------------------------------------------------------------------
2pd3A           ------------------------------------------------DVSKEEHFKSLYNSVKKDLGSL
2o2yD           ----------------------------------------------------------------------
1zxlA           ----------------------------------------------------------------------
1zsnA           ----------------------------------------------------------------------
2o2yC           ----------------------------------------------------------------------
2o2yA           ----------------------------------------------------------------------
1so8A           ----------------------------------------------------------------------
3gy0A           LNDRIILVTGASDGIGREAAMTYARYGATVILLGRSHINEETGDLLTCTSENCQQLAQRIV-VN--YPRL
3f5sB           LNDRIILVTGASDGIGREAAMTYARYGATVILLGRSHINEETGDLLTCTSENCQQLAQRIV-VN--YPRL
3f5sA           LNDRIILVTGASDGIGREAAMTYARYGATVILLGRSHINEETGDLLTCTSENCQQLAQRIV-VN--YPRL
2o50A           ----------------------------------------------------------------------
2jahC           ------------------------------------------------DVADRQGVDAAVASTVEALGGL
2jahA           ------------------------------------------------DVADRQGVDAAVASTVEALGGL
2qq5A           MNGQVCVVTGASRGIGRGIALYITGRHLDTLRVVAQEAQSLGGQCVVCDSSQESEVRSLFEQVDEQQGRL
3g1tA           LQNRIILVTGASDGIGREAALTYARYGATVILLGRNEEQHVQPQWFTLDLCTAEECRQVADRIAAHYPRL
3f1lB           LNDRIILVTGASDGIGREAAMTYARYGATVILLGRSHINEETGDLLTCTSENCQQLAQR-IAVN--YPRL
3f1lA           LNDRIILVTGASDGIGREAAMTYARYGATVILLGRSHINEETGDLLTCTSENCQQLAQR-IAVN--YPRL
2o50B           ----------------------------------------------------------------------
3k2eA           -----------------------------------------------CDVSDAESVDNMFKVLAEEWGSL
3grkD           -----------------------------------------------CDVADAASIDAVFETLEKKWGKL
3grkA           -----------------------------------------------CDVADAASIDAVFETLEKKWGKL
3gz4B           LNDRIILVTGASDGIGREAAMTYARYGATVILLGRSHINEETGQWFILDLSEDCQQLAQRIAVN--YPRL
3gz4A           LNDRIILVTGASDGIGREAAMTYARYGATVILLGRSHINEETGQWFILDLSEDCQQLAQRIAVN--YPRL
3e9nA           ----------------------------------------------------------------------
2bd0A           ------------------------------------------------DISDMADVRRLTTHIVERYGHI
3guyH           ----LIVITGASSGLGAGKATYLTGRSESKLSTVTNCLSNNVGYRAR-DLASHQEVEQLFEQLDSI---P
3guyG           ----LIVITGASSGLGAGKATYLTGRSESKLSTVTNCLSNNVGYRAR-DLASHQEVEQLFEQLDSI---P
3guyD           ----LIVITGASSGLGAGKATYLTGRSESKLSTVTNCLSNNVGYRAR-DLASHQEVEQLFEQLDSI---P
3guyC           ----LIVITGASSGLGAGKATYLTGRSESKLSTVTNCLSNNVGYRAR-DLASHQEVEQLFEQLDSI---P
3grkB           -----------------------------------------------CDVADAASIDAVFETLEKKWGKL
3f5qB           LNDRIILVTGASDGIGREAAMTYARYGATVILLGRSHINEETGQWFILDLSEDCQQLAQRIAVN--YPRL
3f5qA           LNDRIILVTGASDGIGREAAMTYARYGATVILLGRSHINEETGQWFILDLSEDCQQLAQRIAVN--YPRL
3grkG           -----------------------------------------------CDVADAASIDAVFETLEKKWGKL
3e9nC           ----------------------------------------------------------------------
3k2eB           -----------------------------------------------CDVSDAESVDNMFKVLAEEWGSL
3guyA           ----LIVITGASSGLGAGKATYLTGRSESKLSTVTNCLSNNVGYRAR-DLASHQEVEQLFEQLDSI---P


                         .         .         *         .         .         .         .:140
query           DAIINNVGIAIPEPLGKISISALNDVYNLNVRSAVQVSQFFIEKMKLKEQCKIVNIASRAIFGVKNRTSY
2zk7B           SVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISSQASIITKNASAY
2dteA           SVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISSQASIITKNASAY
1i01E           DILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGS-----VVGQANY
1q7bA           DILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVTMGNGGQANY
1q7cA           DILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVTMGNGGQANF
1q7bB           DILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVTMGNGGQANY
1uznA           EVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSSGLWGIGNQANY
2zk7A           SVLVNNA-----------SMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISS-----VKNASAY
1i01B           DILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTGQAN---Y
2uvdA           DILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRHGRIVNIASVVVTGNPGQANY
2hq1A           EDVENMVKTAM-DAFGRIDINAWDDVLNTNLKSAYLCTKAVSKIMLKQKSGKIINITSQA--------NY
2p68A           DILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFGNVGQVNY
1i01A           DILVNNANL-----LMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGS--VVG-----TM
1uzlA           EVLVSNAGLS-----ADMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGS--VSGSWGQANY
1i01F           DILVNNAG----NLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVV----------
1uzlB           EVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSSGSWGIGNQANY
2ph3A           DTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKARFGRIVNITSVVILGNPGQANY
1i01G           DILVNNAD----NLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIG------------Y
1iy8A           DGFFNNAGIEGKQPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGMVVNTASGGIRGIGNQSGY
2c07A           DILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVLTGNVGQANY
1uznB           EVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSSGLWGIGNQANY
1i01H           DILVNNAD----NLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGA----------NY
3gk3B           DVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSRGAFGQAN---Y
1i01C           DILVNNDNL-----LMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVV-------ANY
3f9iA           DILVCNAG-------------DFDKVIDINLKANFILNREAIKKMIQKRYGRIINISS-IVGGNPGQANY
1uzmA           EVLVSNAGLS-----ARMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVS----GNQANY
1o5iA           DILVLNAGGPKAGFFDELTNEDFKEAIDSLFLNMIKIVRNYLPAMKEKGWGRIVAITSFSVISIENLYTS
1i01D           DILVNNDNL-----LMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVV-------ANY
3gk3D           DVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSRGAFGQAN---Y
1gegE           DVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEHGGKIINACSQAHVGNPELAVY
1gegA           DVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEHGGKIINACSQAHVGNPELAVY
3f9iB           DILVCNAGI-----------TDFDKVIDINLKANFILNREAIKKMIQKRYGRXXXXXXXXXXXXPGQANY
3gk3A           DVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSRGAFGQAN---Y
2nm0A           EVLIANAGVTKDQLMSEEDFTS---VVETNLTGTFRVVKRANRAMRAKKGRXXXXXXXXXXXXXXXQANY
3gk3C           DVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSRGAFGQAN---Y
2ntnA           EVLVSNAGLMTEEKFEK--------VINANLTGAFRVAQRASRSMQR-------NKFGRMIFIASVQANY
1edoA           DVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXXXXXXASVVLIGNIGQANY
2ae2A           NILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSSGALAVPYEAVY
1zemA           DFLFNNAGYGAFAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQNYGRIVNTASMAVKGPPNMAAY
2p68B           DILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFGNVGQVNY
2c7vB           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQKTSSNLSIVNLCDAMVDQPMAFSLY
2d1yC           DVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASQGLFAEQENAAY
2c7vA           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLY
1vl8B           DTVVNAAGINRRHPAEEFPLDEFRQVIEVNLFGTYYVCREAFSLLRESDNPSIINIGSLTVEEVTNISAY
1vl8A           DTVVNAAGINRRHPAEEFPLDEFRQVIEVNLFGTYYVCREAFSLLRESDNPSIINIGSLTVEEVTNISAY
2d1yD           DVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASQGLFAEQENAAY
2d1yB           DVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASQGLFAEQENAAY
2d1yA           DVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASQGLFAEQENAAY
2c7vD           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLY
1ae1B           NILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSY
3ftpA           NVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVSAGNPGQVNY
1xr3B           DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERGRIVNIASTGKQGVVHAAPY
3bmqA           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLY
3imfA           DILINNAAGNFICPAEDLSVNGWNSVINIVLNGTFYCSQA-IGKYWIEKGIKIINVATYA-WDAGPGVIH
2ae1A           NILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSSGALAVPYEAVY
2ph3B           DTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKARFGRIVNITS--VVGILNPANY
3bmeC           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLS----IVNLCDAMVDQPMAFSLY
2rhrB           DVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERGRIVNIASTGKQGVVHAAPY
3imfB           DILINNAAGNFICPAEDLSVNGWNSVINIVLNGTFYCSQA-IGKYWIEKGIKIINVATYA-WDAGPGVIH
3i3oF           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSH--LKQGDVIINTASIVAYGNETLIDY
3i3oE           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSH--LKQGDVIINTASIVAYGNETLIDY
3i3oC           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSH--LKQGDVIINTASIVAYGNETLIDY
3i3oB           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSH--LKQGDVIINTASIVAYGNETLIDY
3i3oA           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSH--LKQGDVIINTASIVAYGNETLIDY
3csdB           DVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERGRIVNIASTGKQGVVHAAPY
2ntnB           EVLVSNAGLMTEEKFEK--------VINANLTGAFRVAQRASRSMQR-------NKFGRMIFIASVQANY
3ftpC           NVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVSAGNPGQVNY
3bmeA           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQR---QSNLSIVNLCDAMVDQPMAFSLY
2c7vC           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQKTSSNLSIVNLCDAMVDQPMAFSLY
1x7gB           DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERGRIVNIASTGKQGVVHAAPY
1w4zB           DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERGRIVNIASTGKQGVVHAAPY
1ulsB           DGVVHYAGITRDNFHWK-PLEDWELVLRVNLTGSFLVAKAASEARE-KNPGSIVLTASRVYLGNLGQANY
1ulsA           DGVVHYAGITRDNFHWK-PLEDWELVLRVNLTGSFLVAKAASEARE-KNPGSIVLTASRVYLGNLGQANY
3i3oH           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSH--LKQGDVIINTASIVAYGNETLIDY
3bmfC           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLS----IVNLCDAMVDQPMAFSLY
3bmeB           DVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQNLS----IVNLCDAMVDQPCMAFSY
1xkqB           DVLVNNAGAAIPDAFGTTGTDQGIDIYHKTLKLNLQAVIEMTKKVKVASKGEIVNVSS-IVAGPQAQPDY
1xkqA           DVLVNNAGAAIPDAFGTTGTDQGIDIYHKTLKLNLQAVIEMTKKVKVASKGEIVNVSS-IVAGPQAQPDY
3d3wA           DXXXXXXXXXXXQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGPGAIVNVSSQSQRAVTNHSVY
3bmnD           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPCMAFSY
1uzmB           EVLVSNAG------LSAMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGS------VSQANY
3bmoB           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLS----IVNLCDAMVDQPMAFSLY
3bmjD           DVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQR---QSNLSIVNLCDAMVDQPMAFSLY
3bmfB           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLS----IVNLCDAMVDQPMAFSLY
2wd7B           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLS----IVNLCDAMVDQPCMAFSY
3ftpD           NVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVSAGNPGQVNY
1fmcA           DILVNNAGGGGPKPFD-MPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNNMTSY
3cxtA           DILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMSELGRETVSAY
1ahhA           DILVNNAGGGGPKPFD-MPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNNMTSY
1xg5C           DICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERDDGHIININSMSVLPLSVTHFY
1x7hB           DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERGRIVNIASTGKQGVVHAAPY
1x7gA           DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERGRIVNIASTGKQGVVHAAPY
1w4zA           DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERGRIVNIASTGKQGVVHAAPY
2rhrA           DVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERGRIVNIASTGKQGVVHAAPY
2rh4B           DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERGRIVNIASTGKQGVVHAAPY
2rh4A           DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERGRIVNIASTGKQGVVHAAPY
3cxrA           DILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMSELGRETVSAY
1ae1A           NILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSY
2z1nB           DILVYSTGGPRPGRFMELGVEDWDESYRLLARSAVWVGRRAAEQMVEKGWGRMVYIGSVTLLRPWQDLAL
3bmfD           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQR---QSNLSIVNLCDAMVDQPMAFSLY
2wd7C           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQR---QSNLSIVNLCDAMVDQPCMAFSY
3bmnA           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQS--SNLSIVNLCDAMVDQPMAFSLY
2z1nA           DILVYSTGGPRPGRFMELGVEDWDESYRLLARSAVWVGRRAAEQMVEKGWGRMVYIGSVTLLRPWQDLAL
3grpA           DILVNNAGITV-----RMQDQDWDDVLAVNLTAASTLTRELIHSMMRRRYGRIINITSIG------QTNY
1yxmD           NFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHS
2pd6D           SVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQAL-VSNGCRIINISSIVKVGNVGQTNY
3imfC           DILINNAAGNFICPAEDLSVNGWNSVINIVLNGTFYCSQA-IGKYWIEKGIKIINVATYA-WDAGPGVIH
3bmnC           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQK-SSNLSIVNLCDAMVDQPCMAFSY
2pd6C           SVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQAL-VSNGCRIINISSIVKVGNVGQTNY
3bmoC           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQK-SSNLSIVNLCDAMVDQPCMAFSY
3bmoD           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQK-GSNLSIVNLCDAMVDQPCMAFSY
3bmkC           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQK---NLSIVNLCDAMVDQPCMAFSY
2yz7A           DILVNNAGIQHTAPIEEFPVDKWNAIIALNLSAVFHGTAAALPIMQKQGWGRIINIASHGLVASVNKSAY
2vz0B           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLS----IVNLCDAMVDQPCMAFSY
1ulsC           DGVVHYAGITRDNFHWK-PLEDWELVLRVNLTGSFLVAKAASEARE-KNPGSIVLTASRVYLGNLGQANY
3bmoA           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQKTSSNLSIVNLCDAMVDQPCMAFSY
3bmnB           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQK--SNLSIVNLCDAMVDQPCMAFSY
3bmdB           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLS----IVNLCDAMVDQPCMAFSY
3ezlA           DVLVNNAGITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSNGQKGQFGQTNY
3emkA           DILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXXXXXXTSIVVTGNPGQANY
1cydA           DLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMNRGVPGSIVNVSSMAHVTFPNLITY
1yxmA           NFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHS
1pr9A           DXXXXXXXXXXXQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGPGAIVNVSSQCSQAVTNHSVY
2pd6B           SVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQAL-VSNGCRIINISSIVKVGNVGQTNY
3ennA           DILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXXXXXXTSIVVTGNPGQANY
1xg5A           DICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERDDGHIININSMSVLPLSVTHFY
2vz0A           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQR---QSNLSIVNLCDAMVDQPCMAFSY
3ennB           DILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXXXXXXTSIVVTGNPGQANY
3bmiB           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQRQS--SNLSIVNLCDAMVDQPCMAFSY
3bmfA           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQR---QSNLSIVNLCDAMVDQPCMAFSY
2ag5C           ---------------------------NLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAVKGVVNRCVY
2ag5B           ---------------------------NLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAVKGVVNRCVY
2ag5A           ---------------------------NLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAVKGVVNRCVY
3i3oG           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSH--LKQGDVIINTASIVAYGNETLIDY
1yxmB           NFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHS
3bmqC           DVLVNNASAFYPTPLGKTVETQVAELIGTNAIAPFLLTMSFAQR---QSNLSIVNLCDAMVDQPCMAFSY
2ztmC           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
1xg5B           DICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERDDGHIININSMSVLPLSVTHFY
3emkD           DILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXXXXXXTSIVVTGNPGQANY
2ztvC           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
2ztvB           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
2pd6A           SVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQAL-VSNGCRIINISSIVKVGNVGQTNY
3ennD           DILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXXXXXXTSIVVTGNPGQANY
3ennC           DILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXXXXXXTSIVVTGNPGQANY
2q2vD           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
3emkC           DILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXXXXXXTSIVVTGNPGQANY
1hdcA           DGLVNNAGISTGMFLETESVERFRKVVEINLTGVFIGMKTVIPAMKDAGGGSIVNISSAALMGLALTSSY
3emkB           DILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMXXXXXXXXXXTSIVVTGNPGQANY
2cfcA           DVLVNNAGITGNSEAGVLHVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGVIVNIASVALVAFPGRSAY
2a4kA           HGVAHFAGVAH----SALPLEAWEKVLRVNLTGSFLVARKAGEV--LEEGGSLVLTGSVAGLGAFGLAHY
2ztvD           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
2q2wD           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2q2vC           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
3ijrH           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSH--LKQGDVIINTASIVAYGNETLIDY
3ijrF           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSH--LKQGDVIINTASIVAYGNETLIDY
3ijrE           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSH--LKQGDVIINTASIVAYGNETLIDY
3ijrB           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSH--LKQGDVIINTASIVAYGNETLIDY
3ijrA           NILVNNVAQQYPQQLEYITAEQLEKTFRINIFSYFHVTKAALSH--LKQGDVIINTASIVAYGNETLIDY
3gafD           TVLVNNAGGGGPKPFD-MPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRASY
3gafA           TVLVNNAGGGGPKPFD-MPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRASY
2q2wC           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2zatA           DILVSNAAV---NPFFGNIIDATEEVWDVNVKATVLMTKAVVPEMKRXXXXXXXXXXXXAYHPFPNLGPY
2q2qC           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2q2qA           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
3gafF           TVLVNNAGGGGPKPFD-MPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRASY
1w6uC           NIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVT-LEIGKQLIKAQKGAAFLSITTIYAETGSVPS
1spxA           DILVNNAGQ---------SIESYDATLNLNLRSVIALTKKAVPHLS-STKGEIVNISSIALHATPDFPYY
1ybvA           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
1w6uB           NIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVT-LEIGKQLIKAQKGAAFLSITTIYAETGSVPS
2q2vB           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2q2qG           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2q2qE           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
3gafG           TVLVNNAGGGGPKPFD-MPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRASY
3gafE           TVLVNNAGGGGPKPFD-MPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRASY
3gafC           TVLVNNAGGGGPKPFD-MPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRASY
3gafB           TVLVNNAGGGGPKPFD-MPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRASY
1g0oC           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
1g0oA           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
1dohB           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
1dohA           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
2ztmD           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
2ztlA           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
1w6uA           NIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVT-LEIGKQLIKAQKGAAFLSITTIYAETGSVPS
3grpB           DILVNNAGVRMQD-------QDWDDVLAVNLTAASTLTRELIHSMMRRRYGRIINITSIG------QTNY
2q2qB           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
1h5qA           SGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRA-VAKLWLQKQQKGSIVVTXXXXXXXTQVFY
3gafH           TVLVNNAGGGGPKPFD-MPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRASY
1g0nB           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
2q2wA           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2ztmA           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
2q2qF           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2b4qA           DILVNNAGTSWGAALESYPVSGWEKVMQLNVTSVFSCIQQLLPLLRAENPARVINIGSVAGISAMGEQAY
2q2vA           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2q2qH           DILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASHGLVGSTGKAAY
2ztuD           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
2ztmB           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
1x1tA           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
1w6uD           NIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVT-LEIGKQLIKAQKGAAFLSITTIYAETGSVPS
2ztuC           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
3grpC           -----------------------DDVLAVNLTAASTLTRELIHSMMRRRYGRIINITSI-------QTNY
1yxmC           EEEVNNLVKSTLDTFGKINFLVNNGVLETNLTGTFYMCKAVYSSWMKEHGGSIVNII---VPGFPLAVHS
1x1eA           --------------------------------------------------------------------AY
2ekpA           --------------------------------------------------------------------AY
1xhlA           DIIVNNAGANLADGTANTDVELYQKTFKLNFQAVIEMTQKTKEHL-IKTKGEIVNVSS-IVAGPQAHSGY
2ekqD           --------------------------------------------------------------------AY
2ztuB           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
1ydeP           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLR-KSQGNVINISSLVAIGQAQAVPY
1ydeN           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLR-KSQGNVINISSLVAIGQAQAVPY
1ydeM           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLR-KSQGNVINISSLVAIGQAQAVPY
1ydeI           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLR-KSQGNVINISSLVAIGQAQAVPY
1ydeH           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLR-KSQGNVINISSLVAIGQAQAVPY
1ydeG           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLR-KSQGNVINISSLVAIGQAQAVPY
1ydeF           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLR-KSQGNVINISSLVAIGQAQAVPY
1ydeD           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLR-KSQGNVINISSLVAIGQAQAVPY
1ydeB           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLR-KSQGNVINISSLVAIGQAQAVPY
1ydeA           DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLR-KSQGNVINISSLVAIGQAQAVPY
3grpD           DILVNNAGID----------QDWDDVLAVNLTAASTLTRELIHSMMRRRYGRIINITSI-------QTNY
1ja9A           DFVMSNSGMEVWCDELEVTQELFDKVFNLNTRGQFFVAQQGLKHCRRGGRIILTSSIAAVMTGIPNHALY
2ztuA           DILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASHGLVASANKSAY
1k2wA           DILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGRGKIINMASQALVGV-----Y
2b4qB           DILVNNAGTS--------PVSGWEKVMQLNVTSVFSCIQQLLPLLRAENPARVINIGSVAGISAMGEQAY
2ewmB           DILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWKIEAYTHY
1zjyA           STLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLASIINMSSEGFVGDPSLGAY
1nxqA           STLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLASIINMSSEGFVGDPSLGAY
2ewmA           DILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWKIEAYTHY
2bgkA           DIMFGNVGVLSTTPYSILEAGNFKRVMDINVYGAFLVAKHAARVMIPAKKGSIVFTASISSFTAGEGVSY
2ew8A           DILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWKIEAYTHY
2ew8B           DILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWKIEAYTHY
1e6wA           DVAVNCAGIAVAIKTKKNQVHTLEDVINVNLIGTFNVIRLVAGVMGQNEPDQIINTASVAAFGQVGQAAY
3iccA           DILINNAGIG-PGAFIEETTEQFFDRVSVNAKAPFFIIQQALSR--LRDNSRIINISSAATISLPDFIAY
3i4fC           DFLINNAGPYVFEKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGRIINYGFQGADSAPGRSAF
3i4fD           DFLINNAGPYVFEKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGRIINYGFQGADSAPGRSAF
3i4fA           DFLINNAGPYVFEKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGRIINYGFQGADSAPGRSAF
1e3wA           DVAVNCAGIAVAIKTKKNQVHTLEDVINVNLIGTFNVIRLVAGVMGQNEPDQIINTASVAAFGQVGQAAY
1w73A           NIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVT-LEIGKQLIKAQKGAAFLSITTIYAETGSGFV
1nffA           --LVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSEGLAGTVACHGY
3gvcD           DKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAQVAVGGTGAY
2et6A           HVIINNAGILRDASMKKMTEKDYKLVIDVHLNGAFAVTKAAWPYFQKQKYGRIVNTSSPALYGNFGQANY
1e6wD           DVAVNCAGIAVAIKTKKNQVHTLEDVINVNLIGTFNVIRLVAGVMGQNEPDQIINTASVAAFGQVGQAAY
3gvcC           DKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAQVAVGGTGAY
3gvcB           DKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAQVAVGGTGAY
1w73C           NIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVT-LEIGKQLIKAQKGAAFLSITTIYAETGSGFV
3gvcA           DKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAQVAVGGTGAY
1w73D           NIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVT-LEIGKQLIKAQKGAAFLSITTIYAETGSGFV
1p33C           DVLVNNASSFYPTPLLRKKESAAADLFGSNAIAPYFLIKAFAQRVQRGTSYSIVNMVSQPLLGY---TMY
1p33B           DVLVNNASSFYPTPLLRKKESAAADLFGSNAIAPYFLIKAFAQRVQRGTSYSIVNMVSQPLLGY---TMY
1p33A           DVLVNNASSFYPTPLLRDKESAAADLFGSNAIAPYFLIKAFAQRVQRGTSYSIVNMVSQPLLGY---TMY
3gedB           DVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDEL-IKNKGRIINIASRAFQSEPDSEAY
3gedA           DVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDEL-IKNKGRIINIASRAFQSEPDSEAY
1p33D           DVLVNNASSFYPTPLLRKDKESLEDLFGSNAIAPYFLIKAFAQRVQRGTSYSIVNMVSQPLLGY---TMY
1e6wC           DVAVNCAGIAVAIKTKKNQVHTLEDVINVNLIGTFNVIRLVAGVMGQNEPDQIINTASVAAFGQVGQAAY
2a4kB           ----------------------------------------------------------------------
1xq1A           DILINN--------LGALDYTAEDFSFHINLESAYHLSQLAHPLLKASGCGNIIFMSG---------SIY
1w73B           NIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVT-LEIGKQLIKAQKGAAFLSITTIYAETGSGFV
1uluB           DYLVHAIAFAPREAEGRYIDTRRQDLLALEVSAYSLVAVARRAEPLLREGGGIVTLTYYASEKVVPKYNV
1e6wB           DVAVNCAGIAVAIKTKKNQVHTLEDVINVNLIGTFNVIRLVAGVMGQNEPDQIINTASVAAFGQVGQAAY
1rwbA           DVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFEAIKYFVENDIKGTVINMSSVHEKIPWPLF--VHY
2qioA           HGVAHCIAFANRDDLKGEFVDTSRDGFLL----AQNISAFSLTAVA-REAKKVMNILTLTYLGVKNYNVM
3gegA           DVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDEL-IKNKGRIINIASRAFQSEPDSEAY
2dknA           -----------------------------------------VEAMLAGDEARAIELAEQQ---GQTHLAY
1g6kA           DVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFEAIKYFVENDIKGTVINMSSVHEKIPWPLF--VHY
1nfrA           --LVNNAGILNIGTIEDYALTEWQRILDVNL-TGVFLGIRAVVKPKEAGRGSIINISSEGLAGTVACHGY
1u7tA           DVAVNCAGIAVASKLKKGQTHTLEDVLDVNLMGTFNVIRLVAGEMGQNEPDQIINTASVAAFGQVGQAAY
3diiA           DVLVNNA-CGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDEL-IKNKGRIINIASRAFQSEPDSEAY
1pwxA           DVLVSN-DIFAPEPIDKYAVEDYRGVEALQIRPFALVNAV-ASQMKKRKSGHIIFITSATPFGPKELSTY
1mxfA           DVLVNNASAYYPTPLLPKPIDA--QVAELFGSNAV-APLFLIRAFARRQNLSVVNLCDATDLPLPGFCVY
1geeA           DVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFEAIKYFVENDIKGTVINMSSVHEKIPWPLF--VHY
1e3sA           DVAVNCAGIAVAIKTKKNQVHTLEDVINVNLIGTFNVIRLVAGVMGQNEPDQIINTASVAAFGQVGQAAY
3ctmA           DVFVANAGVTWTQEIDVDNYDSWNKIISVDLNGVYYCSHXXXXXXXXXXXXSLIITSSISGKIVQLQAPY
1uayB           -AVVSAAGVGLAEKIGPHGLESFRRVLEVNLLGTFNVLRLAAWAMRENQRGVIVNTASVAAFGQIGQAAY
1gcoA           DVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFEAIKYFVENDIKGTVINMSSVHEKIPWPLF--VHY
1uayA           -AVVSAAGVGLAEKIGPHGLESFRRVLEVNLLGTFNVLRLAAWAMRENQRGVIVNTASVAAFGQIGQAAY
2qhxC           DVLVNNASSFYPTPLLRAMETATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
3dijA           DVLVNNA-CGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDEL-IKNKGRIINIASRAFQSEPDSEAY
1uluA           DYLVHAIAFAPREAEGRYIDTRRQDLLALEVSAYSLVAVARRAEPLLREGGGIVTLTYYASEKVVPKYNV
1zmoA           DTIVSND--YIPRPMNRLPLEGTSEADIRQMFEALSIFQSAIAPLRAAGGASVIFITSSV--GKKPNPLY
2jjyC           DAIVHSIAFA---PRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNVALTYIGAEKAMPSY
2jjyB           DAIVHSIAFA---PRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNVALTYIGAEKAMPSY
3ctmF           DVFVANAGVTWTQPENKIISVDLNGVYYCSHXXXXXXXXXXXXSLIITSSIKIVNIPQL-------QAPY
2jjyA           DAIVHSIAFA---PRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNVALTYIGAEKAMPSY
2bf7C           DVLVNNASSFYPTPLLEAMETATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
2o23B           DVAVNCAGIAVASKLKKGQTHTLEDVLDVNLMGTFNVIRLVAGEMGQNEPDQIINTASVAAFGQVGQAAY
2o23A           DVAVNCAGIAVASKLKKGQTHTLEDVLDVNLMGTFNVIRLVAGEMGQNEPDQIINTASVAAFGQVGQAAY
1mxhA           DVLVNNASAYYPTPLLPPIDAQVAELFGSNAVAPLFLIRAFARRQS--RNLSVVNLCDAMTLPLPGFCVY
1e7wB           DVLVNNASSFYPTPLLRGDREAMEDLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
2b37B           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
3ek2C           DGLVHSIGFA---PREAIAGDFLDGLTRENFRIAHDISAYSFPALALSDDASLLTLAERAI---PNYNTM
3ctmH           DVFVANAGVTWTQPEIKIISVDLNGVYYCSHXXXXXXXXXXXXSLIITSSIKIVNIPQL-------QAPY
3ctmD           DVFVANAGVTWTQEIDKIISVDLNGVYYCSHXXXXXXXXXXXXSLIITSSIKIVNIPQL-------QAPY
3ctmB           DVFVANAGVTWTQEIDKIISVDLNGVYYCSHXXXXXXXXXXXXSLIITSSIKIVNIPQL-------QAPY
1zbqA           DVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASIYGNFGQANY
1uluD           DYLVHAIAFAPREAEGRYIDTRRQDLLALEVSAYSLVAVARRAEPLLREGGGIVTLTYYASEKVVPKYNV
2p8kH           -------------------------------------------------------------------TIY
2jjyD           DAIVHSIAFA---PRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNVALTYIGAEKAMPSY
2fwmX           DALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQRGGAIVTVASDAAHTPRGMSAY
3ek2A           DGLVHSIGFA---PREAIAGDFLDGLTRENFRIAHDISAYSFPALALSDDASLLTLAERAI---PNYNTM
2yw9H           DYLVHAIAFAPREAMEGRYIDTRRQDWLL----ALEVSAYSLVAVALREGGGIVTLTYYASEKVVPKYNV
2p8kC           DVLVNNASSFYPTPLLRNDREAMEDLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
2bfmC           DVLVNNASSFYPTPLLRREATATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
2bf7B           DVLVNNASSFYPTPLLREAMTATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
1uluC           DYLVHAIAFAPREAEGRYIDTRRQDLLALEVSAYSLVAVARRAEPLLREGGGIVTLTYYASEKVVPKYNV
3ctmE           DVFVANAGVTWTD-----NYDSWNKIISVDLNGVYYCSHXXXXXXXXXXXXSLI-ITSSISGKIQLQAPY
1w0cG           DVLVNNASSFYPTPLLRNDREAMEDLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
2qhxA           DVLVNNASSFYPTPLLREAMTATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
3ek2D           DGLVHSIGFA---PREAIAGDFLDGLTRENFRIAHDISAYSFPALALSDDASLLTLAERAI---PNYNTM
3ctmC           DVFVANAGVTWVD-----NYDSWNKIISVDLNGVYYCSHXXXXXXXXXXXXSLI-ITSSISGKIQLQAPY
2bfoC           DVLVNNASSFYPTPLREAMETATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
2bf7D           DVLVNNASSFYPTPLLRREATATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
2qhxD           DVLVNNASSFYPTPLREAMETATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
1e7wA           DVLVNNASSFYPTPLLREAMTATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
2bfaC           DVLVNNASSFYPTPLLRREATATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
2p8kG           DVLVNNASSFYPTPLLRNDREAMEDLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
2p8kD           DVLVNNASSFYPTPLLRREATATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
3ek2B           DGLVHSIGFA---PREAIAGDFLDGLTRENFRIAHDISAYSFPALALSDDASLLTLAERAI---PNYNTM
1e92B           DVLVNNASSFYPTPLLRREATATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
2bfaD           DVLVNNASSFYPTPLREAMETATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
2yw9B           DYLVHAIAFAPREAMEGRYIDTRRQDWLL----ALEVSAYSLVAVALREGGGIVTLTYYASEKVVPKYNV
1lxcA           DGFVHSIGFA---PGDQLDGDYVNAVTREGFKIAHDISSYSFVAMA--KACRSMLNPGSALLAIPNYNVM
1e92D           DVLVNNASSFYPTPLLRREATATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
1e92C           DVLVNNASSFYPTPLLRNDREAMEDLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
3ctmG           DVFVANAGVTWTVD----NYDSWNKIISVDLNGVYYCSHXXXXXXXXXXXXSLI-ITSSISGKIQLQAPY
2bfpD           DVLVNNASSFYPTPLLRREATATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
2b35B           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
1w0cH           DVLVNNASSFYPTPLLRREATATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
1w0cC           -------------------------------------------------------------------TIY
2bfpB           DVLVNNASSFYPTPLREAMETATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
2bfaB           DVLVNNASSFYPTPLLRGDREAMEDLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
2bfaA           DVLVNNASSFYPTPLREAMETATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
2bf7A           DVLVNNASSFYPTPLREAMETATADLFGSNAIAPYFLIKAFAHRVARGTNYSIINMVNQPLLGY---TIY
1w0cF           -------------------------------------------------------------------TIY
1w0cE           -------------------------------------------------------------------TIY
1w0cB           -------------------------------------------------------------------TIY
1w0cA           -------------------------------------------------------------------TIY
2p8kB           -------------------------------------------------------------------TIY
2p8kA           -------------------------------------------------------------------TIY
2gdzA           DILVNNAGVNNEKNWEKTL-----QINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLALMPVAQQPVY
1e92A           -------------------------------------------------------------------TIY
2bfoA           -------------------------------------------------------------------TIY
2bfmB           -------------------------------------------------------------------TIY
2o2sA           ----------------------------------------------------------------------
1fk8A           KGMDGLVLCAGLGPQTKV----LGNVVSVNYFGATELMDAFLPALKKGHQPXXXXXXXXXXXHLKNNLAY
1dfiA           DGFVHSIGFA---PGDQLDGDYVNAVTREGFKIAHDISSYSFVAMA--KACRSMLNPGSALLAIPNYNVM
1bdbA           DTLIPNAGIALVDLPEESLDAAFDEVFHINVKGYIHAVKACLPALVASRGNVIFTISNAGFYPNGGGPLY
2b35F           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
2b35D           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
2b35C           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
2yw9D           DYLVHAIAFAPREAMEGRYIDTRRQDWLL----ALEVSAYSLVAVALREGGGIVTLTYYASEKVVPKYNV
1i30A           DGFVHSIGFA---PGDQLDGDYVNAVTREGFKIAHDISSYSFVAMA--KACRSMLNPGSALLAIPNYNVM
3fnfB           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
2yw9F           DYLVHAIAFAPREAMEGRYIDTRRQDWLL----ALEVSAYSLVAVALREGGGIVTLTYYASEKVVPKYNV
1qsgG           DGFVHSIGFA---PGDQLDGDYVNAVTREGFKIAHDISSYSFVAMA--KACRSMLNPGSALLAIPNYNVM
1qsgA           DGFVHSIGFA---PGDQLDGDYVNAVTREGFKIAHDISSYSFVAMA--KACRSMLNPGSALLAIPNYNVM
1qg6A           DGFVHSIGFA---PGDQLDGDYVNAVTREGFKIAHDISSYSFVAMA--KACRSMLNPGSALLAIPNYNVM
1hxhA           NVLVNNAGILLPGDMETGRLEDFSRLLKINTESVFIGCQQGIAAMK-ETGGSIINMASSSWLPIEQYAGY
2fhsB           DGFVHSIGFA---PGDQLDGDYVNAVTREGFKIAHDISSYSFVAMA--KACRSMLNPGSALLAIPNYNVM
2ehdB           SALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGGTIVNVGSLAGKNFKGGAAY
1c14A           DGFVHSIGFA---PGDQLDGDYVNAVTREGFKIAHDISSYSFVAMA--KACRSMLNPGSALLAIPNYNVM
2yw9E           DYLVHAIAFAPREAMEGRYIDTRRQDWLL----ALEVSAYSLVAVALREGGGIVTLTYYASEKVVPKYNV
2yw9A           DYLVHAIAFAPREAMEGRYIDTRRQDWLL----ALEVSAYSLVAVALREGGGIVTLTYYASEKVVPKYNV
1yb1A           SILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAHVSVPFLLAY
1gz6A           DVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHKK-QNYGRIITASASGIYGNFGQANY
2aqiA           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
2h7iA           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
1gz6C           DVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHKK-QNYGRIITASASGIYGNFGQANY
1gz6B           DVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHKK-QNYGRIITASASGIYGNFGQANY
1fduC           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1enyA           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
1bhsA           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
2b36B           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
2b35A           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
2aqhA           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
2aq8A           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
1a27A           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
2yw9C           DYLVHAIAFAPREAMEGRYIDTRRQDWLL----ALEVSAYSLVAVALREGGGIVTLTYYASEKVVPKYNV
2p91A           DIIVHSIAYAPKEEFGVIDTSGFKIAMDISVYSLIALTRELLPLMEGRNGAIVTLSYYGAEKVVPHYNVM
1iolA           DVLVCNXXXXXXXXXXXXXXDAVASVLEVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
3fneB           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
2ehdA           SALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGGTIVNVGSLAGKNFKGGAAY
2b35E           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
2p91B           DIIVHSIAYAPKEEFGVIDTSGFKIAMDISVYSLIALTRELLPLMEGRNGAIVTLSYYGAEKVVPHYNVM
1fdvB           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
2dknB           -----------------------------------------VEAMLAGDEARAIELAEQQ---GQTHLAY
2nv6A           DGVVHAIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
2aqkA           DGVVHAIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
3fnfD           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
2b37C           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
2p91D           DIIVHSIAYAPKEEFGVIDTSGFKIAMDISVYSLIALTRELLPLMEGRNGAIVTLSYYGAEKVVPHYNVM
1lx6A           DGFVHSIGFA---PGDQLDGDYVNAVTREGFKIAHDISSYSFVAMA--KACRSMLNPGSALLAIPNYNVM
3fneD           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
1fjhA           KGMDGLVLCAGLGPQTKV----LGNVVSVNYFGATELMDAFLPALKKGHQPXXXXXXXXXXXHLKNNLAY
3fnfC           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
3fneC           DGVVHSIGFM---PQTGMGINPFFDAPYADVSKGIHISAYSYASMA-KALLPIMNPGG-SIVGMDFDPSM
2o2sB           ----------------------------------------------------------------------
1fduD           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1fduB           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1fduA           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1fdsA           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1yb1B           SILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVAS-AHVSVPFLLAY
1qyxA           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1qyvA           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1jtvA           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
1fdwA           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
3deyX           DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
2p91C           DIIVHSIAYAPKEEFGVIDTSGFKIAMDISVYSLIALTRELLPLMEGRNGAIVTLSYYGAEKVVPHYNVM
2ntvA           ----------------------------------------------------------------------
2japC           DILVNNAGIMLLGPVEDADTTDWTRMIDTNLLGLMYMTRAALPHL-LRSKGTVVQMSSIARVNVRNAAVY
2japA           DILVNNAGIMLLGPVEDADTTDWTRMIDTNLLGLMYMTRAALPHL-LRSKGTVVQMSSIARVNVRNAAVY
3edmB           --------------IARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKIVTFSSQADGGGPGALAY
3edmA           --------------IARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKIVTFSSQADGGGPGALAY
1uh5A           ------------------------DALSKSSYSLISLCKYFVNIMK--PQSSIISLTYHASQKVVPGYGM
2op0B           ------------------------DALSKSSYSLISLCKYFVNIMK--PQSSIISLTYHASQKVVPGYGM
2oosB           ------------------------DALSKSSYSLISLCKYFVNIMK--PQSSIISLTYHASQKVVPGYGM
2oosA           ------------------------DALSKSSYSLISLCKYFVNIMK--PQSSIISLTYHASQKVVPGYGM
2ol4B           ------------------------DALSKSSYSLISLCKYFVNIMK--PQSSIISLTYHASQKVVPGYGM
2ol4A           ------------------------DALSKSSYSLISLCKYFVNIMK--PQSSIISLTYHASQKVVPGYGM
1enoA           ----------------------------------------------------------------------
1d7oA           ----------------------------------------------------------------------
1cwuA           ----------------------------------------------------------------------
1vrwA           ------------------------DALSKSSYSLISLCKYFVNIMK--PQSSIISLTYHASQKVVPGYGM
2pd3A           DFIVHSVAFAPKEALEGSLLETSKSAFN----TAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKY
2o2yD           ------------------------DALSKSSYSLISLCKYFVNIMK--PQSSIISLTYHASQKVVPGYGM
1zxlA           ------------------------DALSKSSYSLISLCKYFVNIMK--PQSSIISLTYHASQKVVPGYGM
1zsnA           ------------------------DALSKSSYSLISLCKYFVNIMK--PQSSIISLTYHASQKVVPGYGM
2o2yC           ------------------------DALSKSSYSLISLCKYFVNIMK--PQSSIISLTYHASQKVVPGYGM
2o2yA           ------------------------DALSKSSYSLISLCKYFVNIMK--PQSSIISLTYHASQKVVPGYGM
1so8A           ----------------------------------------------------IINTASVAAFGQVGQAAY
3gy0A           DGVLHNAGLLGDVPMSEQNPQVWQDVMQINVNATFMLTQALLPLLLKSDAGSLVTSSSVGRQGRANWGAY
3f5sB           DGVLHNAGLLGDVPMSEQNPQVWQDVMQINVNATFMLTQALLPLLLKSDAGSLVTSSSVGRQGRANWGAY
3f5sA           DGVLHNAGLLGDVPMSEQNPQVWQDVMQINVNATFMLTQALLPLLLKSDAGSLVTSSSVGRQGRANWGAY
2o50A           ----------------------------------------------------------------------
2jahC           DILVNNAGIL----LGPVEDADTTDWTRIDTNLLGLYTRAALPHL-LRSKGTVVQSSIAGRVNVRNAAVY
2jahA           DILVNNAGIL----LGPVEDADTTDWTRIDTNLLGLYTRAALPHL-LRSKGTVVQSSIAGRVNVRNAAVY
2qq5A           DVLVNNAYAGVQTILNETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPY
3g1tA           DGVLHNAGLGEIGPMSEQDPQIWQDVMQVNVNATFMLTQALLPLLLKSDAGSLVTSSSVGRQGRANWGAY
3f1lB           DGVLHNAGLLGDVPMSEQNPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGSLVTSSSVGRQGRANWGAY
3f1lA           DGVLHNAGLLGDVPMSEQNPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGSLVTSSSVGRQGRANWGAY
2o50B           ----------------------------------------------------------------------
3k2eA           DFVVHAVAFSDKNELGRYVDTSLG-----NFLTSMHISCYSFTYIASKAEPLMTNILTLSYYGAEKVVPH
3grkD           DFLVHAIGFSDKDELTGRYI----DTSEANFTNTMLISVYSLTAVSRRAEKLMADILTLTYYGAENYNVM
3grkA           DFLVHAIGFSDKDELTGRYI----DTSEANFTNTMLISVYSLTAVSRRAEKLMADILTLTYYGAENYNVM
3gz4B           DGVLHNAGLLGDVPMSEQDPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGSLVTSSSVGRQGRANWGAY
3gz4A           DGVLHNAGLLGDVPMSEQDPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGSLVTSSSVGRQGRANWGAY
3e9nA           -----------------------------------------------------------------NNTIY
2bd0A           DCLVNNAGVGRFGALSDLTEEDFDYTMNTNLKGTFFLTQALFALMERQHSGHIFFITSAATKAFRHSSIY
3guyH           STVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYK-DQPVNVVMIMSTAAQQPKAQESY
3guyG           STVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYK-DQPVNVVMIMSTAAQQPKAQESY
3guyD           STVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYK-DQPVNVVMIMSTAAQQPKAQESY
3guyC           STVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYK-DQPVNVVMIMSTAAQQPKAQESY
3grkB           DFLVHAIGFSDKDELTGRYI----DTSEANFTNTMLISVYSLTAVSRRAEKLMADILTLTYYGAENYNVM
3f5qB           DGVLHNAGLLGDVPMSEQDPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGSLVTSSSVGRQGRANWGAY
3f5qA           DGVLHNAGLLGDVPMSEQDPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGSLVTSSSVGRQGRANWGAY
3grkG           DFLVHAIGFSDKDELTGRYI----DTSEANFTNTMLISVYSLTAVSRRAEKLMADILTLTYYGAENYNVM
3e9nC           -----------------------------------------------------------------NNTIY
3k2eB           DFVVHAVAFSDKNELGRYVDTSLG-----NFLTSMHISCYSFTYIASKAEPLMTNILTLSYYGAEKVVPH
3guyA           STVVHSAGSGYFGLLQEQDPEQIQTLIENNLSSAINVLRELVKRYK-DQPVNVVMIMSTAAQQPKAQESY


                         +         .         .         .         .         *         .:210
query           SAAKSALVGCTKTWALELAKYGICVNAIAPGPVDTELFRKTRPIGSSEEKEVLDSIPMMRIGKPEEIAAT
2zk7B           VTSKHAVIGLTKSIALDYAPLLRC-NAVCPATIDTPLVRKAAEVGSDPEKKISEEHPMQRIGKPQEVASA
2dteA           VTSKHAVIGLTKSIALDYAPLLRC-NAVCPATIDTPLVRKAAEVGSDPEKKISEEHPMQRIGKPQEVASA
1i01E           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDM---TRALSDDQRAGILAQVPAGRLGGAQEIANA
1q7bA           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDM---TRALSDDQRAGILAQVPAGRLGGAQEIANA
1q7cA           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDM---TRALSDDQRAGILAQVPAGRLGGAQEIANA
1q7bB           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTR-----SDDQRAGILAQVPAGRLGGAQEIANA
1uznA           AASKAGVIGMARSIARELSKANVTANVVAPGYIDTDM---TRALDERIQQGALQFIPAKRVGTPAEVAGV
2zk7A           VTSKHAVIGLTKSIALDYAPLLRC-NAVCPATIDTPLVRKAAEVGSDPEKKISEEHPMQRIGKPQEVASA
1i01B           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETS---------DDQRAGILAQVPAGRLGGAQEIANA
2uvdA           VAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDM---TDVLDENIKAEMLKLIPAAQFGEAQDIANA
2hq1A           AASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDM---TDVLPDKVKEMYLNNIPLKRFGTPEEVANV
2p68A           STTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDM---TAVLSEEIKQKYKEQIPLGRFGSPEEVANV
1i01A           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDM---TRALSDDQRAGILAQVPAGRLGGAQEIANA
1uzlA           AASKAGVIGMARSIARELSKANVTANVVAPGYIDTDM---TRALDERIQQGALQFIPAKRVGTPAEVAGV
1i01F           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDM---TRALSDDQRAGILAQVPAGRLGGAQEIANA
1uzlB           AASKAGVIGMARSIARELSKANVTANVVAPGYIDT----------------ALQFIPAKRVGTPAEVAGV
2ph3A           VASKAGLIGFTRAVAKEYAQRGITVNAVAPGFIETEM---TERLPQEVKEAYLKQIPAGRFGRPEEVAEA
1i01G           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDM---TRALSDDQRAGILAQVPAGRLGGAQEIANA
1iy8A           AAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQLDPENEEFIQVNPSKRYGEAPEIAAV
2c07A           SSSKAGVIGFTKSLAKELASRNITVNAIAPGFISS--------ISEQIKKNIISNIPAGRMGTPEEVANL
1uznB           AASKAGVIGMARSIARELSKANVTANVVAPGYIDT----------------ALQFIPAKRVGTPAEVAGV
1i01H           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALQRAG------ILAQVPAGRLGGAQEIANA
3gk3B           ASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVEAVPQ--DVLEAKILPQIPVGRLGRPDEVAAL
1i01C           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTR--------ARAGILAQVPAGRLGGAQEIANA
3f9iA           CASKAGLIGMTKSLSYEVATRGITVNAVAPGFIK---------LNEKQREAIVQKIPLGTYGIPEDVAYA
1uzmA           AASKAGVIGMARSIARELSKANVTANVVAPGYIDTDM---TRALDERIQQGALQFIPAKRVGTPAEVAGV
1o5iA           NSARMALTGFLKTLSFEVAPYGITVNCVAPGWTETERVKEL--LSEEKKKQVESQIPMRRMAKPEEIASV
1i01D           AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETAL-------SDDQRAGILAQVPAGRLGGAQEIANA
3gk3D           ASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVEAVPQ--DVLEAKILPQIPVGRLGRPDEVAAL
1gegE           SSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIKPLGYG-TAEFAKRITLGRLSEPEDVAAC
1gegA           SSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIKPLGYG-TAEFAKRITLGRLSEPEDVAAC
3f9iB           CASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDM---TDKLNEKQREAIVQKIPLGTYGIPEDVAYA
3gk3A           ASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMV---------EAAKILPQIPVGRLGRPDEVAAL
2nm0A           AASKAGLVGFARSLARELGSRNITFNVVAPGFVDTQ------------RANIVSQVPLGRYARPEEIAAT
3gk3C           ASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVAK-----------ILPQIPVGRLGRPDEVAAL
2ntnA           AASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTR------ALDQQGALQFIPAKRVGTPAEVAGV
1edoA           AAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM---TAKLGEDMEKKILGTIPLGRTGQPENVAGL
2ae2A           GATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMT--IQDPEQKELIDRCALRRMGEPKELAAM
1zemA           GTSKGAIIALTETAALDLAPYNIRVNAISPGYMQVELQAKVGSQYFSTDQQMIGSVPMRRYGDINEIPGV
2p68B           STTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDM--------TAVLQKYKEQIPLGRFGSPEEVANV
2c7vB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
2d1yC           NASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIALSPDPERDWEDLHALRRLGKPEEVAEA
2c7vA           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
1vl8B           AASKGGVASLTKALAKEWGRYGIRVNVIAPGWYRTKM---TEAVFSDPEKYMLKRIPLGRTGVPEDLKGV
1vl8A           AASKGGVASLTKALAKEWGRYGIRVNVIAPGWYRTKM---TEAVFSDPEKYMLKRIPLGRTGVPEDLKGV
2d1yD           NASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEA--IATRRDWEDLHAL--RRLGKPEEVAEA
2d1yB           NASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEA--IRTRRDWEDLHAL--RRLGKPEEVAEA
2d1yA           NASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAV-----LEAIARRDWEDLHALRRLGKPEEVAEA
2c7vD           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
1ae1B           SASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVEKKNPHQKEEIDNFIVKTPMGRAGKPQEVSAL
3ftpA           AAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDM---TKGLPQEQQTALKTQIPLGRLGSPEDIAHA
1xr3B           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREVSTEEADRITARVPIGRYVQPSEVAEM
3bmqA           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
3imfA           SAAAKAGVLATKTLAVEWGKYGIRVNAIAPGPIERT--------GGAEAKRTIQSVPLGRLGTPEEIAGL
2ae1A           GATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATQ-----DPEQKENLNKLIDRCALRRMGEPKELAAM
2ph3B           VASKAGLIGFTRAVAKEYAQRGITVNAV----IETEM---TERLPQEVKEAYLKQIPAGRFGRPEEVAEA
3bmeC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGSLLPDKWRRKVPLGRRE-------------ASAEQIADA
2rhrB           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHTEEAFDRITARVPIGRYVQPSEVAEM
3imfB           SAAAKAGVLATKTLAVEWGKYGIRVNAIAPGPIE-------RTGGADEEKRTIQSVPLGRLGTPEEIAGL
3i3oF           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPS-----SFDEKKVSQNVPMQRPGQPYELAPA
3i3oE           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPS-----SFDEKKVSQNVPMQRPGQPYELAPA
3i3oC           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPS-----SFDEKKVSQNVPMQRPGQPYELAPA
3i3oB           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPS-----SFDEKKVSQNVPMQRPGQPYELAPA
3i3oA           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPS-----SFDEKKVSQNVPMQRPGQPYELAPA
3csdB           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHTEEAFDRITARVPIGRYVQPSEVAEM
2ntnB           AASKAGVIGMARSIARELSKANVTANVVAPGYIDT-----------------LQFIPAKRVGTPAEVAGV
3ftpC           AAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKE-------QQTALKTQIPLGRLGSPEDIAHA
3bmeA           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
2c7vC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
1x7gB           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVR-----EFDRITARVPIGRYVQPSEVAEM
1w4zB           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYTEEADRITARVPIGRYVQPSEVAEM
1ulsB           -AASAGVVGLTRTLALELGRWGIRVNTLAPGFIET----RTAKVPEKVREKAIAATPLGRAGKPLEVAYA
1ulsA           -AASAGVVGLTRTLALELGRWGIRVNTLAPGFIET----RTAKVPEKVREKAIAATPLGRAGKPLEVAYA
3i3oH           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWT-------PLIPSSFSQFGSNVPMQRPGQPYELAPA
3bmfC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGV----------SLGEEEKDKWRRKVPLRREASAEQIADA
3bmeB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
1xkqB           AIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVETGFTNAMGMPDQASQKSHKECIPIGAAGKPEHIANI
1xkqA           AIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVETGFTNAMGMPDQASQKSHKECIPIGAAGKPEHIANI
3d3wA           CSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWS-DPHKAKTMLNRIPLGKFAEVEHVVNA
3bmnD           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
1uzmB           AASKAGVIGMARSIARELSKANVTANVVAPGYIDT----------------ALQFIPAKRVGTPAEVAGV
3bmoB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
3bmjD           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
3bmfB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
2wd7B           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
3ftpD           AAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTD----------EQQTALKTQIPLGRLGSPEDIAHA
1fmcA           ASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSV--ITPEIEQKMLQHTPIRRLGQPQDIANA
3cxtA           AAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATP---QTHPF----DQFIIAKTPAARWGEAEDLMGP
1ahhA           ASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSV--ITPEIEQKMLQHTPIRRLGQPQDIANA
1xg5C           SATKYAVTALTEGLRQELAQTHIRATCISPGVVETQFAFK---LHDKDPEKAAATYEQMKCLKPEDVAEA
1x7hB           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVRDIWEVSTEEAFDRIPIGRYVQPSEVAEM
1x7gA           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVRDIWEVSTEEAFDRIPIGRYVQPSEVAEM
1w4zA           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVRDIWEVSTEEAFDRIPIGRYVQPSEVAEM
2rhrA           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVRDIWEVSTEEAFDRIPIGRYVQPSEVAEM
2rh4B           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVRDIWEVSTEEAFDRIPIGRYVQPSEVAEM
2rh4A           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVRDIWEVSTEEAFDRIPIGRYVQPSEVAEM
3cxrA           AAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATP---QTAPLRELHDQFIIAKTPAARWGEAEDLMGP
1ae1A           SASKGAINQMTKSLACEWAKDNIRVNSVAPGVI----------LQKEEIDNFIVKTPMGRAGKPQEVSAL
2z1nB           SIMRLPVIGVVRTLALELAPHGVTVNAVLPSLILTDRVRSL---------SMASRIPMGRVGKPEELASV
3bmfD           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
2wd7C           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
3bmnA           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
2z1nA           SIMRLPVIGVVRTLALELAPHGVTVNAVLPSLILTDRVRR---------------IPMGRVGKPEELASV
3grpA           CAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKSAM---TDKLNEKQKEAIMAMIPMKRMGIGEEIAFA
1yxmD           GAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSV
2pd6D           AASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPM---TQKVPQKVVDKITEMIPMGHLGDPEDVADV
3imfC           SAAAKAGVLATKTLAVEWGKYGIRVNAIAPGPIE-------------RAKRTIQSVPLGRLGTPEEIAGL
3bmnC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
2pd6C           AASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPM---TQKVPQKVVDKITEMIPMGHLGDPEDVADV
3bmoC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
3bmoD           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
3bmkC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
2yz7A           VAAKHGVVGLTKVTALENAGKGITCNAICPGWVRTPLVEKQIEAISQQKRELLEKQPSLQFVTPEQLGGA
2vz0B           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
1ulsC           -AASAGVVGLTRTLALELGRWGIRVNTLAPGFIETP--EKVR-------EKAIAATPLGRAGKPLEVAYA
3bmoA           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
3bmnB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
3bmdB           NMGKHALVGLTQSAALELAPYGIRVNGVAPG------VSLLPAMGEEEKDKWRRKVPLRREASAEQIADA
3ezlA           STAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRP---DVLEKIVATIPVRRLGSPDEIGSI
3emkA           CASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAM--------EKQKDAIMGNIPMKRMGVGADIAAA
1cydA           SSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKK---VSADPERKLKERHPLRKFAEVEDVVNS
1yxmA           GAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSV
1pr9A           CSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWS-DPHKAKTMLNRIPLGKFAEVEHVVNA
2pd6B           AASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPM---TQKVPQKVVDKITEMIPMGHLGDPEDVADV
3ennA           CASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIE-----------SKQKDAIMGNIPMKRMGVGADIAAA
1xg5A           SATKYAVTALTEGLRQELAQTHIRATCISPGVVETQFAFKL------HDKDPEKAAATYECLKPEDVAEA
2vz0A           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
3ennB           CASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESN---------EKQKDAIMGNIPMKRMGVGADIAAA
3bmiB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
3bmfA           NMGKHALVGLTQSAALELAPYGIRVNGVAPG------VSLLPAMGEEEKDKWRRKVPLRREASAEQIADA
2ag5C           STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTSLQERIQARGNPEENDFLKRQKTGRFATAEEIAML
2ag5B           STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTSLQERIQARGNPEENDFLKRQKTGRFATAEEIAML
2ag5A           STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTSLQERIQARGNPEENDFLKRQKTGRFATAEEIAML
3i3oG           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIGS-------------------NVPMQRPGQPYELAPA
1yxmB           GAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQT-------AQSFFEGSFQKIPAKRIGVPEEVSSV
3bmqC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGPV---------AMGEEEKDKWRRKVPLRREASAEQIADA
2ztmC           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRSPLVEK--QISALAEKELLEKQPSLQFVTPEQLGGT
1xg5B           SATKYAVTALTEGLRQELAQTHIRATCISPGVVETQFAFKLH----------------MKCLKPEDVAEA
3emkD           CASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIEEK-----------QKDAIMGNIPMKRMGVGADIAAA
2ztvC           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISAGVDQERELLEKQPSLQFVTPEQLGGT
2ztvB           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKTAARELLSEKQ-----PSLQFVTPEQLGGT
2pd6A           AASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPM-------------KITEMIPMGHLGDPEDVADV
3ennD           CASKAGLIGFSKSLAQEIASRNVTVNCIAPGFI--------------EKDAIMGNIPMKRMGVGADIAAA
3ennC           CASKAGLIGFSKSLAQEIASRNVTVNCIAPGFI--------------EKDAIMGNIPMKRMGVGADIAAA
2q2vD           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRQAQHDLLAEKQPSLAFVTPEHLGEL
3emkC           CASKAGLIGFSKSLAQEIASRNVTVNCIAPG------FEK-------QKDAIMGNIPMKRMGVGADIAAA
1hdcA           GASKWGVRGLSKLAAVELGTDRIRVNSVHPGMTYTPMTAET---GIRQGEGNYPNTPMGRVGEPGEIAGA
3emkB           CASKAGLIGFSKSLAQEIASRNVTVNCIAPGFI---------------KDAIMGNIPMKRMGVGADIAAA
2cfcA           TTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMWRLDQP---ELRDQVLARIPQKEIGTAAQVADA
2a4kA           AAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGLPPWAWEQE---VGASPLGRAGRPEEVAQA
2ztvD           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISVDETAARELLEKQPSLQFVTPEQLGGT
2q2wD           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDPLQAQHDLLEKQPSLAFVTPEHLGEL
2q2vC           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRLQAQHDLLEKQPSLAFVTPEHLGEL
3ijrH           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIP-----SSFDEKKVFGSNVPQRPGQPYELAPA
3ijrF           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIP-----SSFDEKKVFGSNVPQRPGQPYELAPA
3ijrE           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIP-----SSFDEKKVFGSNVPQRPGQPYELAPA
3ijrB           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIP-----SSFDEKKVFGSNVPQRPGQPYELAPA
3ijrA           SATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIP-----SSFDEKKVFGSNVPQRPGQPYELAPA
3gafD           GSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDV------LTPEIERAMLKHTPLGRLGEAQDIANA
3gafA           GSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATV--LTPEIERAMLKHTPLGRLGEAQDIANA
2q2wC           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDGQAQHDLLAEKQPSLAFVTPEHLGEL
2zatA           NVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTN-FSQVLWMDKARKEYMKESLRIRRLGNPEDCAGI
2q2qC           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQ----IAQHDLLAEKQPSLAFVTPEHLGEL
2q2qA           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKDRDPLQAQHDLLAEKQPSLAFVTPEHLGEL
3gafF           GSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDAV-----LTPEIERAMLKHTPLGRLGEAQDIANA
1w6uC           ASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTGAF-------GTFEKEMIGRIPCGRLGTVEELANL
1spxA           SIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVATGFY--------STMATMKECVPAGVMGQPQDIAEV
1ybvA           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYREYIPNGENLSNEEVDEYPLRRVGLPIDIARV
1w6uB           ASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTGTF----------EKEMIGRIPCGRLGTVEELANL
2q2vB           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKDRAAGQAQHDLLAEKQPSLAFVTPEHLGEL
2q2qG           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKAAPL-QAQHDLLAEKQPSLAFVTPEHLGEL
2q2qE           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRALQAQHDLEKQPSLAFVTPEHLGEL
3gafG           GSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDT--------PEIERAMLKHTPLGRLGEAQDIANA
3gafE           GSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAI------KTTP---EIERAMLKHTPLGRLGEAQDIANA
3gafC           GSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDT--------PEIERAMLKHTPLGRLGEAQDIANA
3gafB           GSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTD---------PEIERAMLKHTPLGRLGEAQDIANA
1g0oC           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYREYIPNGENLSNEEVDEYPLRRVGLPIDIARV
1g0oA           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYREYIPNGENLSNEEVDEYPLRRVGLPIDIARV
1dohB           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYREYIPNGENLSNEEVDEYPLRRVGLPIDIARV
1dohA           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYREYIPNGENLSNEEVDEYPLRRVGLPIDIARV
2ztmD           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRSPLVEKQ----ISARELLSEKQPSLQFVTPEQLGGT
2ztlA           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEK--QISALAEKNGVDKQPSLQFVTPEQLGGT
1w6uA           ASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKT-----LDPTGTFE-KEMIGRIPCGRLGTVEELANL
3grpB           CAAKAGLIGFSKALAQEIASRNITVNCIAPGFI---------------KSAIMAMIPMKRMGIGEEIAFA
2q2qB           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQDPL-QAQHDLLAEKQPSLAFVTPEHLGEL
1h5qA           NSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTD---QTAHMDKKIRDHQASNIPLNRFAQPEEMTGQ
3gafH           GSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTPEI----------ERAMLKHTPLGRLGEAQDIANA
1g0nB           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYH-------ADEYAAVQWSPLRRVGLPIDIARV
2q2wA           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQDPL-QAQHDLLAEKQPSLAFVTPEHLGEL
2ztmA           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRSPLVEK--QISALAEKNGVDKQPSLQFVTPEQLGGT
2q2qF           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPL---------AQHDLLAEKQPSLAFVTPEHLGEL
2b4qA           APSKAALHQLSRMLAKELVGEHINVNVIAPGRFPS---RMTRHIANDPQALEADSIPMGRWGRPEEMAAL
2q2vA           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQDPL-QAQHDLLAEKQPSLAFVTPEHLGEL
2q2qH           VAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLT-------PPLQAQHDLLAEKQPSLAFVTPEHLGEL
2ztuD           VAAKHGVVGFTKVTALETAGQGITANAICPGWV-----RETAARELLSEKQ-----PSLQFVTPEQLGGT
2ztmB           VAAKHGVVGFTKVTALETAGQGITANAICPGWV-----RSARELLSEKQ-------PSLQFVTPEQLGGT
1x1tA           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRTLLSEKQ---------------PSLQFVTPEQLGGT
1w6uD           ASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTF------------EKEMIGRIPCGRLGTVEELANL
2ztuC           VAAKHGVVGFTKVTALETAGQGITANAICPGWVRQE---------TAARELLSEKQPSLQFVTPEQLGGT
3grpC           CAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKKEA--------------IMAMIPMKRMGIGEEIAFA
1yxmC           GAARAGVYNLTKSLALEWACSGIRINCVAPGVI----YSQTAVFEGSFQK-----IPAKRIGVPEEVSSV
1x1eA           TTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEF---TLPLRQNPEEPITARIPMGRWARPEEIARV
2ekpA           TTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEF---TLPLRQNPEEPITARIPMGRWARPEEIARV
1xhlA           ACAKAALDQYTRCTAIDLIQHGVRVNSVSPGAVATGFMGAMGLPETASDKSRKECIPVGHCGKPEEIANI
2ekqD           TTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETELY-----------EPITARIPMGRWARPEEIARV
2ztuB           VAAKHGVVGFTKVTALETAGQGITANAICPGWVEL-----------LSEKQ-----PSLQFVTPEQLGGT
1ydeP           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELMPDPRASIREGMLAQPLGRMGQPAEVGAA
1ydeN           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEPRASI-----REGMLAQPLGRMGQPAEVGAA
1ydeM           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELMPDPRASIREGMLAQPLGRMGQPAEVGAA
1ydeI           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELMPDPRASIREGMLAQPLGRMGQPAEVGAA
1ydeH           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELMPDPRASIREGMLAQPLGRMGQPAEVGAA
1ydeG           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELMPDPRASIREGMLAQPLGRMGQPAEVGAA
1ydeF           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELMPDPRASIREGMLAQPLGRMGQPAEVGAA
1ydeD           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELMPDPRASIREGMLAQPLGRMGQPAEVGAA
1ydeB           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEPRASI-----REGMLAQPLGRMGQPAEVGAA
1ydeA           VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELMPDPRASIREGMLAQPLGRMGQPAEVGAA
3grpD           CAAKAGLIGFSKALAQEIASRNITVNCIAPG--------------------FIKMIPMKRMGIGEEIAFA
1ja9A           AGSKAAVEGFCRAFAVDCGAKGVTVNCIAPGGVKTDMFDENSYKGMPQEKGLANMNPLKRIGYPADIGRA
2ztuA           VAAKHGVVGFTKVTALETAGQGITANAICPGWV----------------RLLSEKQPSLQFVTPEQLGGT
1k2wA           CATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEKFADYENLPRGEKKQVGAAVPFGRMGRAEDLTGM
2b4qB           APSKAALHQLSRMLAKELVGEHINVNVIAPGRFPS---RMTRHIANDPQALEADSIPMGRWGRPEEMAAL
2ewmB           ISTKAANIGFTRALASDLGKDGITVNAIAPSLV------RTATTEASALSAMFDVLPNMRLQVPLDLTGX
1zjyA           NASKGAVRIMSKSAALDCADYDVRVNTVHPGYIKTPLVDDLP--GAEEAMSQRTKTPMGHIGEPNDIAYI
1nxqA           NASKGAVRIMSKSAALDCADYDVRVNTVHPGYIKTPLVDDLP--GAEEAMSQRTKTPMGHIGEPNDIAYI
2ewmA           ISTKAANIGFTRALASDLGKDGITVNAIAPSLVRT--------------ATTLQAIPRLQV--PLDLTGX
2bgkA           TATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDVFGVDSSRVEELAHQAANLKLLRAEDVADA
2ew8A           ISTKAANIGFTRALASDLGKDGITVNAIAPSLVN-----------------MLQAIPRLQV--PLDLTGX
2ew8B           ISTKAANIGFTRALASDLGKDGITVNAIAPSLV------------------MLQAIPRLQV--PLDLTGX
1e6wA           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTKVRNFLASQ-------VPFSRLGDPAEYAHL
3iccA           ST--KGAINTTFTLAKQLGARGITVNAILPGFVKTDNAELL-----SDPKQYATTISAFRLGEVEDIADT
3i4fC           AAAKVGLVSLTKTVAYEEAEYGITANMVCPGDI----------IGEMKEATIQEA-RQLRSGTGEDIART
3i4fD           AAAKVGLVSLTKTVAYEEAEYGITANMVCPGDI----------IGEMKEATIQEARQLIRSGTGEDIART
3i4fA           AAAKVGLVSLTKTVAYEEAEYGITANMVCPGDI----------IGEMKEATIQEA-RQLRSGTGEDIART
1e3wA           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTTVRNFLASQ-------VPFSRLGDPAEYAHL
1w73A           SASAKAGVEASKSLAAEWGKYGR-FNVIQPGPIKT-----LDPTGTFEKE--IGRIPCGRLGTVEELANL
1nffA           TATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPM--------TDWVPEDIFQTALGRAAEPVEVSNL
3gvcD           GMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAGGARSMIARLQG----RMAAPEEMAGI
2et6A           ASAKSALLGFAETLAKEGAKYNIKANAIA-------------PLARSRMTESIMPPPMLEKLGPEKVAPL
1e6wD           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGPLLTTLPDKVRNFLASQ-------VPFSRLGDPAEYAHL
3gvcC           GMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMFDGALGGARSMIARLRMAAPEEMAGI
3gvcB           GMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMFDGALGGARSMIARLRMAAPEEMAGI
1w73C           SASAKAGVEASKSLAAEWGKYGR-FNVIQPGPIKTT---------GTFEKEI-GRIPCGRLGTVEELANL
3gvcA           GMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMFGGARSMIARL--QGRMAAPEEMAGI
1w73D           SASAKAGVEASKSLAAEWGKYGR-FNVIQPGPI------KTKEIGR---------IPCGRLGTVEELANL
1p33C           TMAKEALEGLTRSAALELASLQIRVNGVSPG---LSVLPDDMPF--SVQEDYRRKVPLQRNSSAEEVSDV
1p33B           TMAKEALEGLTRSAALELASLQIRVNGVSPG---LSVLPDDMPF--SVQEDYRRKVPLQRNSSAEEVSDV
1p33A           TMAKEALEGLTRSAALELASLQIRVNGVSPG---LSVLPDDMPF--SVQEDYRRKVPLQRNSSAEEVSDV
3gedB           ASAKGGIVALTHALAMSLGP-DVLVNCIAPGWINVTEFTQ----------EDCAAIPAGKVGTPKDISNM
3gedA           ASAKGGIVALTHALAMSLGP-DVLVNCIAPGWINVTEFTQ----------EDCAAIPAGKVGTPKDISNM
1p33D           TMAKEALEGLTRSAALELASLQIRVNGVSPG---LSVLPDDMPF--SVQEDYRRKVPLQRNSSAEEVSDV
1e6wC           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTNF----------LASQVPFSRLGDPAEYAHL
2a4kB           -----------RTLALELARKGVRVNVLLPGLIQ------------AWEQEVGAS-PLGRAGRPEEVAQA
1xq1A           SATKGALNQLARNLACEWASDGIRANAVAPAVI---------------------------AGEPEEVSSL
1w73B           SASAKAGVEASKSLAAEWGKYGR-FNVIQPGPI--------------KEKEI-GRIPCGRLGTVEELANL
1uluB           AIAKAALEASVRYLAYELGPKGVRVNAISAGPVRTVAARSIP--GFTKYDRVAQTAPLRRNITQEEVGNL
1e6wB           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLL-----------TFLASQVPFSRLGDPAEYAHL
1rwbA           AASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPI--NAEKFADPEQRADVESIPMGYIGEPXXXXXX
2qioA           GVAKASLEASVKYLANDLGQHGIRVNAISAGPIRT-LSAKGVGDFNSILREIEERAPLRRTTTQEEVGDT
3gegA           ASAKGGIVALTHALAMSLGP-DVLVNCIAPGWINVTF-----------TQEDCAAIPAGKVGTPKDISNM
2dknA           AGSKYAVTCLARRNVVDWAGRGVRLNVVAPGAVETPLLQASKADPRYGESTRRFVAPLGRGSEPREVAEA
1g6kA           AASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPI--NAEKFADPEQRADVESIPMGYIGEPXXXXXX
1nfrA           TATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTP---------TDWVPEDIFQTALGRAAEPVEVSNL
1u7tA           SASKGGIVGMTLPIARDLAPIGIRVMTIAPGPLLTSLPEKVRNFLASQ-------VPFSRLGDPAEYAHL
3diiA           ASAKGGIVALTHALAMSLGP-DVLVNCIAPGWINVTEFTQ----------EDCAAIPAGKVGTPKDISNM
1pwxA           TSARAGACTLANALSKELGEYNIPVFAIGPNYLDSPYFYPTEPWKTNPEHHVKKVTALQRLGTQKELGEL
1mxfA           TA-KHALGGLTRAAALELAPRHIRVNAVAPG------LSLLPPAPQETQEEYRRKVPLXXXXXXXXXXXX
1geeA           AASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPI--NAEKFADPEQRADVESIPMGYIGEPXXXXXX
1e3sA           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATP-----------------SQVPFSRLGDPAEYAHL
3ctmA           NTAKAACTHLAKSLAIEWAPFAR-VNTISPGYIDTDI---TDFASKDMKAKWWQLTPLGREGLTQELVGG
1uayB           AASKGGVVALTLPAARELAGWGIRVVTVAPGLFDT-------PLPEKAKASLAAQVPFPRLGRPEEYAAL
1gcoA           AASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPI--NAEKFADPEQRADVESIPMGYIGEPXXXXXX
1uayA           AASKGGVVALTLPAARELAGWGIRVVTVAPGLFDTPLL---QGLPEKAKASLAAQVPFPRLGRPEEYAAL
2qhxC           TMAKGALEGLTRSAALELAPLQIRVNGVGPGSVLVEGHRSKVPL-------------YQRDSSAAEVSDV
3dijA           ASAKGGIVALTHALAMSLGP-DVLVNCIAPGWINVTF-----------TQEDCAAIPAGKVGTPKDISNM
1uluA           AIAKAALEASVRYLAYELGPKGVRVNAISAGPVFTKYDR------------VAQTAPLRRNITQEEVGNL
1zmoA           GPARAATVALVESAAKTLSRDGILLYAIGPNFFNNPTYFPTSDWENNPERERVDDVPLGRLGRPDEMGAL
2jjyC           NTAKASLEATVRYTALALGEDGIKVNAVSAGPIDY----------NAMVSPLKKNVDIMEVGN------T
2jjyB           NTAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLMVSPLKK-----------NVDIMEVGN------T
3ctmF           NTAKAACTHLAKSLAIEWAPFAR-VNTISPGYIDTDI---TDFASKDMKAKWWQLTPLGREGLTQELVGG
2jjyA           NTAKASLEATVRYTALALGEDGIKVNAVSAGPI----------------KKMLDYNAMVSPLKKNEVGNT
2bf7C           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPL-------------YQRDSSAAEVSDV
2o23B           SASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLL-----------NFLASQVPFSRLGDPAEYAHL
2o23A           SASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPNF-------------LASQVPFSRLGDPAEYAHL
1mxhA           TMAKHALGGLTRAAALELAPRHIRVNAVAPG---LSLLPPAMP--QETQEEYRRKVPLXXXXXXXXXXXX
1e7wB           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLVDWEGHRSKVPL-------------YQRDSSAAEVSDV
2b37B           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEGWDQRAPIGWN----MKDATP---------VAKT
3ek2C           GLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKTSFGKILDFVESNS--------PLKRNVTIEQVGNA
3ctmH           NTAKAACTHLAKSLAIEWAPFAR-VNTISPGYIDTDI---TDFASKDMKAKWWQLTPLGREGLTQELVGG
3ctmD           NTAKAACTHLAKSLAIEWAPFAR-VNTISPGYIDTDI---TDFASKDMKAKWWQLTPLGREGLTQELVGG
3ctmB           NTAKAACTHLAKSLAIEWAPFAR-VNTISPGYIDTDI---TDFASKDMKAKWWQLTPLGREGLTQELVGG
1zbqA           SAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGS----RMTQTVMPEDLVEAL---------KPEYVAPL
1uluD           AIAKAALEASVRYLAYELGPKGVRVNAISAGPV-------------RKYDRVAQTAPLRRNITQEEVGNL
2p8kH           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLVDDEGHRSKVPL-------------YQRDSSAAEVSDV
2jjyD           NTAKASLEATVRYTALALGEDGIKVNAVSAGPIKMLDY-------NAMVSPLKKNVDIMEVGN------T
2fwmX           GXXXXXXXXXXXXVGLELAGSGVRCNVVSPGST-----------------------------RPQEIANT
3ek2A           GLAKAALEASVRYLAVSLGAKGVRVNAISAGPIS----------GIKSFGKILDFVPLKRNVTIEQVGNA
2yw9H           MAAKAALEASVRYLAYELGPKGVRVNAISAGPVFTKMYDR-----------VAQTAPLRRNITQEEVGNL
2p8kC           TMAKGALEGLTRSAALELAPLQIRVNGVGPGSVLVEGHRSKVPL-------------YQRDSSAAEVSDV
2bfmC           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPL-------------YQRDSSAAEVSDV
2bf7B           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
1uluC           AIAKAALEASVRYLAYELGPKGVRVNAISAGPV---------------YDRVAQTAPLRRNITQEEVGNL
3ctmE           NTAKAACTHLAKSLAIEWAPFAR-VNTISPGYIDTDI---TDFASKDMKAKWWQLTPLGREGLTQELVGG
1w0cG           TMAKGALEGLTRSAALELAPLQIRVNGVGPGL--SVLVDDMPPEGHRSK------VPLQRDSSAAEVSDV
2qhxA           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
3ek2D           GLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKS--FGKILDFVESNS-------PLKRNVTIEQVGNA
3ctmC           NTAKAACTHLAKSLAIEWAPFAR-VNTISPGYIDTDI---TDFASKDMKAKWWQLTPLGREGLTQELVGG
2bfoC           TMAKGALEGLTRSAALELAPLQIRVNGVGPGSVLVDGHRSKVPL-------------YQRDSSAAEVSDV
2bf7D           TMAKGALEGLTRSAALELAPLQIRVNGVGPGL--SVLVRSKVPL-------------YQRDSSAAEVSDV
2qhxD           TMAKGALEGLTRSAALELAPLQIRVNGVGPGSVLVEGHRSKVPL-------------YQRDSSAAEVSDV
1e7wA           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
2bfaC           TMAKGALEGLTRSAALELAPLQIRVNGVGPGL--SVLVRSKVPL-------------YQRDSSAAEVSDV
2p8kG           TMAKGALEGLTRSAALELAPLQIRVNGVGPGVDDMEGHRSKVPL-------------YQRDSSAAEVSDV
2p8kD           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLVDDMVWEGHR-----------SKVPLQRDSSAAEVSDV
3ek2B           GLAKAALEASVRYLAVSLGAKGVRVNAISAGPIK---FGKILDFVESNS-------PLKRNVTIEQVGNA
1e92B           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
2bfaD           TMAKGALEGLTRSAALELAPLQIRVNGVGPG-LSVLVHRSKVPL-------------YQRDSSAAEVSDV
2yw9B           MAAKAALEASVRYLAYELGPKGVRVNAISAGPV--RVAARSIPGFTKMYDRVAQTAPLRRNITQEEVGNL
1lxcA           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRT-LFRKM--LAHCEAVT-----PIRRTVTIEDVGNS
1e92D           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPL-------------YQRDSSAAEVSDV
1e92C           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPL-------------YQRDSSAAEVSDV
3ctmG           NTAKAACTHLAKSLAIEWAPFAR-VNTISPGYIDTDI---TDFASKDMKAKWWQLTPLGREGLTQELVGG
2bfpD           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPL-------------YQRDSSAAEVSDV
2b35B           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEEWDQRAPIGWN----MKDATP---------VAKT
1w0cH           TMAKGALEGLTRSAALELAPLQIRVNGVGPGSVLVAVWEGHR-----------SKVPLQRDSSAAEVSDV
1w0cC           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPL-------------YQRDSSAAEVSDV
2bfpB           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
2bfaB           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
2bfaA           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
2bf7A           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
1w0cF           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
1w0cE           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
1w0cB           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
1w0cA           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
2p8kB           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
2p8kA           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
2gdzA           CASKHGIVGFTRSAALNLMNSGVRLNAICPGFVNTESIEKEENMGQYIEDHIKDMIKYYGILDPPLIANG
1e92A           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
2bfoA           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
2bfmB           TMAKGALEGLTRSAALELAPLQIRVNGVGPG---LSVLVDDMPPAVWEGHR--SKVPLQRDSSAAEVSDV
2o2sA           SSAKAALESDTRTLAWEAGKYGVRVNAISAGPLKS---RAASAIGKSGEKSFIDNAPLRRDLHSDDVGGA
1fk8A           AGSKNALTVAVRKRAAAWGEAGVRLNTIAPGATETPFVP-----------------PMGRRAEPSEMASV
1dfiA           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLMLAHCEAV-----------TPIRRTVTIEDVGNS
1bdbA           TAAKHAIVGLVRELAFELAPY-VRVNGVGSGGINSDL---RGPSSLGPLADMLKSVPIGRMPEVEETGAY
2b35F           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTQIWDQRAPIGWN----MKDATP---------VAKT
2b35D           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEGWDQRAPIGWN----MKDATP---------VAKT
2b35C           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEGWDQRAPIGWN----MKDATP---------VAKT
2yw9D           MAAKAALEASVRYLAYELGPKGVRVNAISAGPVGTKMYDR-----------VAQTAPLRRNITQEEVGNL
1i30A           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRT--FRKM--LAHCEAVT-----PIRRTVTIEDVGNS
3fnfB           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEGWDQRAPIGWN----MKDATP---------VAKT
2yw9F           MAAKAALEASVRYLAYELGPKGVRVNAISAGPYD----------------RVAQTAPLRRNITQEEVGNL
1qsgG           GLAKASLEANVRYMANAMGPEGVRVNAISAGPI-----RTLAASGIKDFRKMLAHCPIRRTVTIEDVGNS
1qsgA           GLAKASLEANVRYMANAMGPEGVRVNAISAGPI-----RTLAASGIKDFRKMLAHCPIRRTVTIEDVGNS
1qg6A           GLAKASLEANVRYMANAMGPEGVRVNAISAGPI-----RTLAASGIKDFRKMLAHCPIRRTVTIEDVGNS
1hxhA           SXXXXXXXXXXXXXXXXCRKYAIRVNSIHPDGIYTPMMQASLPKGVSKEM-VLHDPKLNRAGRPERIAQL
2fhsB           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTKDFRKM--LAHCEAVT-----PIRRTVTIEDVGNS
2ehdB           NASKFXXXXXXXXXMLDLREANVRVVNVLPGSV-------------------------------------
1c14A           GLAKASLEANVRYMANAMGPEGVRVNAISAGPI-----RTLAASGIKDFRKMLAHCPIRRTVTIEDVGNS
2yw9E           MAAKAALEASVRYLAYELGPKGVRVNAISAGPVRKMYDR------------VAQTAPLRRNITQEEVGNL
2yw9A           MAAKAALEASVRYLAYELGPKGVRVNAISAGPV---------------RDRVAQTAPLRRNITQEEVGNL
1yb1A           CSSKFAAVGFHKTLTDELAALGVKTTCLCPNFVNTGFIKNSTSLGPTLEPEEVVNRLMHGILTEQKIPSS
1gz6A           SAAKLGLLGLANTLVIEGRKNNIHCNTIAPN------------AGSRTETVPEDLVEAL---KPEYVAPL
2aqiA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT--LAMSAIVGGALGEEAGAQIQLLEEGWDQRVAKT
2h7iA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT--LAMSAIVGGALGEEAGAQIQLLEEGWDQRVAKT
1gz6C           SAAKLGLLGLANTLVIEGRKNNIHCNTIAP----------------------------------------
1gz6B           SAAKLGLLGLANTLVIEGRKNNIHCNTIAP----------------------------------------
1fduC           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKV--LGSPE--EVLD----------------
1enyA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT--LAMSAIVGGALGEEAGAQIQLLEEGWDQRVAKT
1bhsA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKV--LGSPE--EVLD----------------
2b36B           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTALGEEAGAQIQLLEEGWDQRAPIMKDATP--VAKT
2b35A           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEGWDQRAPIGWN----MKDATP---------VAKT
2aqhA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT--LAMSAIVGGALGEEAGAQIQLLEEGWDQRVAKT
2aq8A           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT--LAMSAIVGGALGEEAGAQIQLLEEGWDQRVAKT
1a27A           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKV--LGSPE--EVLD----------------
2yw9C           MAAKAALEASVRYLAYELGPKGVRVNAISAGPV---------------YDRVAQTAPLRRNITQEEVGNL
2p91A           GIAKAALESTVRYLAYDIAKHGHRINAISAGPV------KTLAAITGFHLLMEHTTKVNPFGKPEDVGDT
1iolA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKV--LGSPE--EVLD----------------
3fneB           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEGWDQRAPIGWN----MKDATP---------VAKT
2ehdA           NASKFXXXXXXXXXMLDLREANVRVVNVLPG---------------------------------------
2b35E           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEGWDQRAPIGWN----MKDATP---------VAKT
2p91B           GIAKAALESTVRYLAYDIAKHGHRINAISAGPVKTLAATGFHLLMEHTTK-------VNPFGKPEDVGDT
1fdvB           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTEVLDRT-----------------------------
2dknB           AGSKYAVTCLARRNVVDWAGRGVRLNVVAPG---------VAPLGRGSE--------------PREVAEA
2nv6A           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT--LAMSAIVGGALGEEAGAQIQLLEEGWDQRVAKT
2aqkA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT--LAMSAIVGGALGEEAGAQIQLLEEGWDQRVAKT
3fnfD           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEGWDQRAPIGWN----MKDATP---------VAKT
2b37C           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTGALGEEAGAQIQLLEEGWDQAPIMKDATP--VAKT
2p91D           GIAKAALESTVRYLAYDIAKHGHRINAISAGPV--------------------------KFGKPEDVGDT
1lx6A           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIMLAHCEAVTPI--------------RRTVTIEDVGNS
3fneD           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEGWDQRAPIGWN----MKDATP---------VAKT
1fjhA           AGSKNALTVAVRKRAAAWGEAGVRLNTIAPGAFVP---------------------PMGRRAEPSEMASV
3fnfC           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEGWDQRAPIGWN----MKDATP---------VAKT
3fneC           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT--LAMSAIVGGEEAGAQIQLLENMKDATP--VAKT
2o2sB           SSAKAALESDTRTLAWEAGKYGVRVNAISAGPLKS---RAASAIG--KEKSFIDNAPLRRDLHSDDVGGA
1fduD           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEK------------------------------
1fduB           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEK------------------------------
1fduA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEK------------------------------
1fdsA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTVL-------GSPE--EVLD----------------
1yb1B           CSSKFAAVGFHKTLTDELAALGVKTTCLCPNFVNTGFIKNSTSLGPTLEPEEVVNRLMHGILTEQKIPSS
1qyxA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT-----------------------------------
1qyvA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT-----------------------------------
1jtvA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT-----------------------------------
1fdwA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT-----------------------------------
3deyX           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT-----------------------------------
2p91C           GIAKAALESTVRYLAYDIAKHGHRINAISAGPVPITI---------------------------EDVGDT
2ntvA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT--LAMSAIVGGAFGEEAGAQMQLLEEGDPTPVAKT
2japC           QATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDTELRGHITHTATKEMYE--QRISQIRKLQAQDIAEA
2japA           QATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDTELRGHITHTATKEMYE--QRISQIRKLQAQDIAEA
3edmB           ATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGMISTT-----------------------REGSSEDVAGL
3edmA           ATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGMIST------------------------REGSSEDVAGL
1uh5A           SSAKAALESDTRVLAYHLGRYNIRINTISAGPLKSRAATAINTFIDYAIEYSEKYAPLRQKLLSTDIGSV
2op0B           SSAKAALESDTRVLAYHLGRYNIRINTISAGPLKSRAATAITFIDYAIEYSEKYA-PLRQKLLSTDIGSV
2oosB           SSAKAALESDTRVLAYHLGRYNIRINTISAGPLKSRAATAINTFIDYAIEYSEKYAPLRQKLLSTDIGSV
2oosA           SSAKAALESDTRVLAYHLGRYNIRINTISAGPLKSRAATAITFIDYAIEYSEKYA-PLRQKLLSTDIGSV
2ol4B           SSAKAALESDTRVLAYHLGRYNIRINTISAGPLKSRAATAINTFIDYAIEYSEKYAPLRQKLLSTDIGSV
2ol4A           SSAKAALESDTRVLAYHLGRYNIRINTISAGPLKSTFIDYA--IEYSEKYA-----PLRQKLLSTDIGSV
1enoA           SSAKAALESDTRVLAFEAGKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSY-NNAPIQKTLTADEVGNA
1d7oA           SSAKAALESDTRVLAFEAGKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSY-NNAPIQKTLTADEVGNA
1cwuA           SSAKAALESDTRVLAFEAGKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSY-NNAPIQKTLTADEVGNA
1vrwA           SSAKAALESDTRVLAYHLGRYNIRINTISAGPL------KSRAATAINKYTFIDYAPLRQKLLSTDIGSV
2pd3A           MAAKAALESAVRYLAVDLGKHHIRVNALSAGPI-----RTLASSGIADFRMILKNAPLRKNVSLEEVGNA
2o2yD           SSAKAALESDTRVLAYHLGRYNIRINTISAGPLKSRAATAIYTFIDYAIEYSEKYAPLRQKLLSTDIGSV
1zxlA           SSAKAALESDTRVLAYHLGRYNIRINTISAGPLKSRAATAINYTFIDYAIEYSEKYPLRQKLLSTDIGSV
1zsnA           SSAKAALESDTRVLAYHLGRYNIRINTISAGPLKSRAATAINYTFIDYAIEYSEKYPLRQKLLSTDIGSV
2o2yC           SSAKAALESDTRVLAYHLGRYNIRINTISAGPLKSRAATAINYTFIDYAIEYSEKYPLRQKLLSTDIGSV
2o2yA           SSAKAALESDTRVLAYHLGRYNIRINTISAGPLKSRAATAINYTFIDYAIEYSEKYPLRQKLLSTDIGSV
1so8A           SASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPL---------------------------------
3gy0A           AASKFATEGMMQVLADEY-QQRLRVNCINPGGTRTAMRASAFPTEDPQKKTPADIMPL------------
3f5sB           AASKFATEGMMQVLADEY-QQRLRVNCINPGGTRTPQKLKT-----------------------------
3f5sA           AASKFATEGMMQVLADEY-QQRLRVNCINPGGTRTPQKLKT-----------------------------
2o50A           SSAKAALESDTRTLAWEAGKYGVRVNAISAGPLKSFI---DYAIDYS-----YNNAPLRRDLHSDDVGGA
2jahC           QATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDTEL---RGHITHTATKEYEQRISQIRKLQAQDIAEA
2jahA           QATKFGVNAFSETLRQEVTERGVRVVVIEPGTTDTEL---RGHITHTATKEYEQRISQIRKLQAQDIAEA
2qq5A           GVGXXXXXXXXXXXXHELRRHGVSCVSLWPGIVQTEL---------------------------------
3g1tA           ATSKFATEGMMQVLADEYQNRSLRVNCINPGGTRTSMRASAFPTEDPQKKTPADIMPL------------
3f1lB           AASKFATEGMMQVLADEY-QQRLRVNCINPGGTRTAMRASAFPTEDPQKKTPADIMPL------------
3f1lA           AASKFATEGMMQVLADEY-QQRLRVNCINPGGTRTAMRASAFPTEDPQKKTPADIMPL------------
2o50B           SSAKAALESDTRTLAWEAGKYGVRVNAISAGPLSFIDY----AIDYS-----YNNAPLRRDLHSDDVGGA
3k2eA           GVCKAALEASVKYLAVDLGKQQIRVNAISAGPV-----RTLASSGISDFHYILTNSPLRRNTTLDDVGGA
3grkD           GVAKAALEASVKYLAVDLGPQNIRVNAISAGPIKTLAAGDFRYILKWNEY----NAPLRRTVTIDEVGDV
3grkA           GVAKAALEASVKYLAVDLGPQNIRVNAISAGPIKTGDFRYILKWNEY-------NAPLRRTVTIDEVGDV
3gz4B           AASKFATEGMMQVLADEY-QQRLRVNCINPGGTRTAMRASAFPTEDPQKKTPADIMPL------------
3gz4A           AASKFATEGMMQVLADEY-QQRLRVNCINPGGTRTAMRASAFPTEDPQKKTPADIMPL------------
3e9nA           AASKHALRGLADAFRKEEANNGIRVSTVSPGPTRPEIYIEPKEIANA-----------------------
2bd0A           CMSKFGQRGLVETMRLYARKCNVRITDVQPGAVYTPMWGKV--------DDEMQALMMM----PEDIAAP
3guyH           CAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATEFW--------------------------------
3guyG           CAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATEFW--------------------------------
3guyD           CAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATEFW--------------------------------
3guyC           CAVKWAVKGLIESVRLELKGKPMKIIAVYPGGMATEFW--------------------------------
3grkB           GVAKAALEASVKYLAVDLGPQNIRVNAISAGPIKT-------LAASGDFRYILKNAPLRRTVTIDEVGDV
3f5qB           AASKFATEGMMQVLADEY-QQRLRVNCINPG---------------------------------------
3f5qA           AASKFATEGMMQVLADEY-QQRLRVNCINPG---------------------------------------
3grkG           GVAKAALEASVKYLAVDLGPQNIRVNAISAGPIKGDF----RYILKWNEY----NAPLRRTVTIDEVGDV
3e9nC           AASKHALRGLADAFRKEEANNGIRVSTVSPGPEPKEIANAIR----------------------------
3k2eB           GVCKAALEASVKYLAVDLGKQQIRVNAISAGPV------------RSDFHYILTNSPLRRNTTLDDVGGA
3guyA           CAVKWAVKGLIESVRLELKGKPMKIIAVYPG---------------------------------------


                         .         .         .         +         .         .         .:280
query           IAFLLSNEASFITGQVICVDGGGSL
2zk7B           VAFLASREASFITGTCLYVDGGLSI
2dteA           VAFLASREASFITGTCLYVDGGLSI
1i01E           VAFLASDEAAYITGETLHVNGG---
1q7bA           VAFLASDEAAYITGETLHVNGG---
1q7cA           VAFLASDEAAYITGETLHVNGG---
1q7bB           VAFLASDEAAYITGETLHVNGG---
1uznA           VSFLASEDASYISGAVIPVDGG---
2zk7A           VAFLASREASFITGTCLYVDGGLSI
1i01B           VAFLASDEAAYITGETLHVNGG---
2uvdA           VTFFASDQSKYITGQTLNVDGG---
2hq1A           VGFLASDDSNYITGQVINIDGG---
2p68A           VLFLCSELASYITGEVIHVNGG---
1i01A           VAFLASDEAAYITGETLHVNGG---
1uzlA           VSFLASEDASYISGAVIPVDGG---
1i01F           VAFLASDEAAYITGETLHVNGG---
1uzlB           VSFLASEDASYISGAVIPVDGG---
2ph3A           VAFLVSEKAGYITGQTLCVDGG---
1i01G           VAFLASDEAAYITGETLHVNGG---
1iy8A           VAFLLSDDASYVNATVVPIDGGQS-
2c07A           ACFLSSDKSGYINGRVFVIDGG---
1uznB           VSFLASEDASYISGAVIPVDGG---
1i01H           VAFLASDEAAYITGETLHVNGG---
3gk3B           IAFLCSDDAGFVTGADLAINGG---
1i01C           VAFLASDEAAYITGETLHVNGG---
3f9iA           VAFLASNNASYITGQTLHVNGG---
1uzmA           VSFLASEDASYISGAVIPVDGG---
1o5iA           VAFLCSEKASYLTGQTIVVDGG---
1i01D           VAFLASDEAAYITGETLHVNGG---
3gk3D           IAFLCSDDAGFVTGADLAINGG---
1gegE           VSYLASPDSDYMTGQSLLIDGG---
1gegA           VSYLASPDSDYMTGQSLLIDGG---
3f9iB           VAFLASNNASYITGQTLHVNGG---
3gk3A           IAFLCSDDAGFVTGADLAINGG---
2nm0A           VRFLASDDASYITGAVIPVDGG---
3gk3C           IAFLCSDDAGFVTGADLAINGG---
2ntnA           VSFLASEDASYISGAVIPVDGG---
1edoA           VEFLLSPAASYITGQAFTIDGG---
2ae2A           VAFLCFPAASYVTGQIIYVDGG---
1zemA           VAFLLGDDSSFMTGVNLPIAGG---
2p68B           VLFLCSELASYITGEVI--------
2c7vB           VIFLVSGSAQYITGSIIKVDGGLSL
2d1yC           VLFLASEKASFITGAILPVDGG---
2c7vA           VIFLVSGSAQYITGSIIKVDGGLSL
1vl8B           AVFLASEEAKYVTGQIIFVDGG---
1vl8A           AVFLASEEAKYVTGQIIFVDGG---
2d1yD           VLFLASEKASFITGAILPVDGG---
2d1yB           VLFLASEKASFITGAILPVDGG---
2d1yA           VLFLASEKASFITGAILPVDGG---
2c7vD           VIFLVSGSAQYITGSIIKVDGGLSL
1ae1B           IAFLCFPAASYITGQIIWADGG---
3ftpA           VAFLASPQAGYITGTTLHVNGG---
1xr3B           VAYLIGPGAAAVTAQALNVCGG---
3bmqA           VIFLVSGSAQYITGSIIKVDGGLSL
3imfA           AYYLCSDEAAYING--TCTDGGQHL
2ae1A           VAFLCFPAASYVTGQIIYVDGG---
2ph3B           VAFLVSEKAGYITGQTLCVDGG---
3bmeC           VIFLVSGSAQYITGSIIKVDGGLSL
2rhrB           VAYLIGPGAAAVTAQALNVCGG---
3imfB           AYYLCSDEAAYING--TCTDGGQHL
3i3oF           YVYLASSDSSYVTGQMIHVNGG---
3i3oE           YVYLASSDSSYVTGQMIHVNGG---
3i3oC           YVYLASSDSSYVTGQMIHVNGG---
3i3oB           YVYLASSDSSYVTGQMIHVNGG---
3i3oA           YVYLASSDSSYVTGQMIHVNGG---
3csdB           VAYLIGPGAAAVTAQALNVCGG---
2ntnB           VSFLASEDASYISGAVIPVDGG---
3ftpC           VAFLASPQAGYITGTTLHVNGG---
3bmeA           VIFLVSGSAQYITGSIIKVDGGLSL
2c7vC           VIFLVSGSAQYITGSIIKVDGGLSL
1x7gB           VAYLIGPGAAAVTAQALNVCGG---
1w4zB           VAYLIGPGAAAVTAQALNVCGG---
1ulsB           ALFLLSDESSFITGQVLFVDGGRTI
1ulsA           ALFLLSDESSFITGQVLFVDGGRTI
3i3oH           YVYLASSDSSYVTGQMIHVNGG---
3bmfC           VIFLVSGSAQYITGSIIKVDGGLSL
3bmeB           VIFLVSGSAQYITGSIIKVDGGLSL
1xkqB           ILFLADRNLSFILGQSIVADGGTSL
1xkqA           ILFLADRNLSFILGQSIVADGGTSL
3d3wA           ILFLLSDRSGMTTGSTLPVEGG---
3bmnD           VIFLVSGSAQYITGSIIKVDGGLSL
1uzmB           VSFLASEDASYISGAVIPVDGG---
3bmoB           VIFLVSGSAQYITGSIIKVDGGLSL
3bmjD           VIFLVSGSAQYITGSIIKVDGGLSL
3bmfB           VIFLVSGSAQYITGSIIKVDGGLSL
2wd7B           VIFLVSGSAQYITGSIIKVDGGLSL
3ftpD           VAFLASPQAGYITGTTLHVNGG---
1fmcA           ALFLCSPAASWVSGQILTVSGGG--
3cxtA           AVFLASDASNFVNGHILYVDGG---
1ahhA           ALFLCSPAASWVSGQILTVSGGG--
1xg5C           VIYVLSTPAHIQIGDI---------
1x7hB           VAYLIGPGAAAVTAQALNVCGG---
1x7gA           VAYLIGPGAAAVTAQALNVCGG---
1w4zA           VAYLIGPGAAAVTAQALNVCGG---
2rhrA           VAYLIGPGAAAVTAQALNVCGG---
2rh4B           VAYLIGPGAAAVTAQALNVCGG---
2rh4A           VAYLIGPGAAAVTAQALNVCGG---
3cxrA           AVFLASDASNFVNGHILYVDGG---
1ae1A           IAFLCFPAASYITGQIIWADGG---
2z1nB           VAFLASEKASFITGAVIPVDGGAHI
3bmfD           VIFLVSGSAQYITGSIIKVDGGLSL
2wd7C           VIFLVSGSAQYITGSIIKVDGGLSL
3bmnA           VIFLVSGSAQYITGSIIKVDGGLSL
2z1nA           VAFLASEKASFITGAVIPVDGGAHI
3grpA           TVYLASDEAAYLTGQTLHINGG---
1yxmD           VCFLLSPAASFITGQSVDVDGGRSL
2pd6D           VAFLASEDSGYITGTSVEVTGG---
3imfC           AYYLCSDEAAYING--TCTDGGQHL
3bmnC           VIFLVSGSAQYITGSIIKVDGGLSL
2pd6C           VAFLASEDSGYITGTSVEVTGG---
3bmoC           VIFLVSGSAQYITGSIIKVDGGLSL
3bmoD           VIFLVSGSAQYITGSIIKVDGGLSL
3bmkC           VIFLVSGSAQYITGSIIKVDGGLSL
2yz7A           AVFLSSAAADQMTGTTLSLDGG---
2vz0B           VIFLVSGSAQYITGSIIKVDGGLSL
1ulsC           ALFLLSDESSFITGQVLFVDGGRTI
3bmoA           VIFLVSGSAQYITGSIIKVDGGLSL
3bmnB           VIFLVSGSAQYITGSIIKVDGGLSL
3bmdB           VIFLVSGSAQYITGSIIKVDGGLSL
3ezlA           VAWLASEESGFSTGADFSLNGG---
3emkA           VVYLASDEAAYVTGQTLHVNGG---
1cydA           ILFLLSDRSASTSGGGILVDAG---
1yxmA           VCFLLSPAASFITGQSVDVDGGRSL
1pr9A           ILFLLSDRSGMTTGSTLPVEGG---
2pd6B           VAFLASEDSGYITGTSVEVTGG---
3ennA           VVYLASDEAAYVTGQTLHVNGG---
1xg5A           VIYVLSTPAHIQIGDI---------
2vz0A           VIFLVSGSAQYITGSIIKVDGGLSL
3ennB           VVYLASDEAAYVTGQTLHVNGG---
3bmiB           VIFLVSGSAQYITGSIIKVDGGLSL
3bmfA           VIFLVSGSAQYITGSIIKVDGGLSL
2ag5C           CVYLASDESAYVTGNPVIIDGGWSL
2ag5B           CVYLASDESAYVTGNPVIIDGGWSL
2ag5A           CVYLASDESAYVTGNPVIIDGGWSL
3i3oG           YVYLASSDSSYVTGQMIHVNGG---
1yxmB           VCFLLSPAASFITGQSVDVDGGRSL
3bmqC           VIFLVSGSAQYITGSIIKVDGGLSL
2ztmC           AVFLASDAAAQITGTTVSVDGG---
1xg5B           VIYVLSTPAHIQIGDI---------
3emkD           VVYLASDEAAYVTGQTLHVNGG---
2ztvC           AVFLASDAAAQITGTTVSVDGG---
2ztvB           AVFLASDAAAQITGTTVSVDGG---
2pd6A           VAFLASEDSGYITGTSVEVTGG---
3ennD           VVYLASDEAAYVTGQTLHVNGG---
3ennC           VVYLASDEAAYVTGQTLHVNGG---
2q2vD           VLFLCSEAGSQVRGAAWNVDGG---
3emkC           VVYLASDEAAYVTGQTLHVNGG---
1hdcA           VVKLLSDTSSYVTGAELAVDGG---
3emkB           VVYLASDEAAYVTGQTLHVNGG---
2cfcA           VMFLAGEDATYVNGAALVMDG----
2a4kA           ALFLLSEESAYITGQALYVDGGRSI
2ztvD           AVFLASDAAAQITGTTVSVDGG---
2q2wD           VLFLCSEAGSQVRGAAWNVDGG---
2q2vC           VLFLCSEAGSQVRGAAWNVDGG---
3ijrH           YVYLASSDSSYVTGQ-IHVNGG---
3ijrF           YVYLASSDSSYVTGQ-IHVNGG---
3ijrE           YVYLASSDSSYVTGQ-IHVNGG---
3ijrB           YVYLASSDSSYVTGQ-IHVNGG---
3ijrA           YVYLASSDSSYVTGQ-IHVNGG---
3gafD           ALFLCSPAAAWISGQVLTVSGGG--
3gafA           ALFLCSPAAAWISGQVLTVSGGG--
2q2wC           VLFLCSEAGSQVRGAAWNVDGG---
2zatA           VSFLCSEDASYI-------------
2q2qC           VLFLCSEAGSQVRGAAWNVDGG---
2q2qA           VLFLCSEAGSQVRGAAWNVDGG---
3gafF           ALFLCSPAAAWISGQVLTVSGGG--
1w6uC           AAFLCSDYASWINGAVIKFDGG---
1spxA           IAFLADRKSSYIIGHQLVVDGGSSL
1ybvA           VCFLASNDGGWVTGKVIGIDGGACM
1w6uB           AAFLCSDYASWINGAVIKFDGG---
2q2vB           VLFLCSEAGSQVRGAAWNVDGG---
2q2qG           VLFLCSEAGSQVRGAAWNVDGG---
2q2qE           VLFLCSEAGSQVRGAAWNVDGG---
3gafG           ALFLCSPAAAWISGQVLTVSGGG--
3gafE           ALFLCSPAAAWISGQVLTVSGGG--
3gafC           ALFLCSPAAAWISGQVLTVSGGG--
3gafB           ALFLCSPAAAWISGQVLTVSGGG--
1g0oC           VCFLASNDGGWVTGKVIGIDGGACM
1g0oA           VCFLASNDGGWVTGKVIGIDGGACM
1dohB           VCFLASNDGGWVTGKVIGIDGGACM
1dohA           VCFLASNDGGWVTGKVIGIDGGACM
2ztmD           AVFLASDAAAQITGTTVSVDGG---
2ztlA           AVFLASDAAAQITGTTVSVDGG---
1w6uA           AAFLCSDYASWINGAVIKFDGG---
3grpB           TVYLASDEAAYLTGQTLHINGG---
2q2qB           VLFLCSEAGSQVRGAAWNVDGG---
1h5qA           AILLLSDHATYMTGGEYFIDGG---
3gafH           ALFLCSPAAAWISGQVLTVSGGG--
1g0nB           VCFLASNDGGWVTGKVIGIDGGACM
2q2wA           VLFLCSEAGSQVRGAAWNVDGG---
2ztmA           AVFLASDAAAQITGTTVSVDGG---
2q2qF           VLFLCSEAGSQVRGAAWNVDGG---
2b4qA           AISLAGTAGAYMTGNVIPIDGG---
2q2vA           VLFLCSEAGSQVRGAAWNVDGG---
2q2qH           VLFLCSEAGSQVRGAAWNVDGG---
2ztuD           AVFLASDAAAQITGTTVSVDGG---
2ztmB           AVFLASDAAAQITGTTVSVDGG---
1x1tA           AVFLASDAAAQITGTTVSVDGG---
1w6uD           AAFLCSDYASWINGAVIKFDGG---
2ztuC           AVFLASDAAAQITGTTVSVDGG---
3grpC           TVYLASDEAAYLTGQTLHINGG---
1yxmC           VCFLLSPAASFITGQSVDVDGGRSL
1x1eA           AAVLCGDEAEYLTGQAVAVDGG---
2ekpA           AAVLCGDEAEYLTGQAVAVDGG---
1xhlA           IVFLADNLSSYIIGQSIVADGGSTL
2ekqD           AAVLCGDEAEYLTGQAVAVDGG---
2ztuB           AVFLASDAAAQITGTTVSVDGG---
1ydeP           AVFLAS-EANFCTGIELLVTGGAEL
1ydeN           AVFLAS-EANFCTGIELLVTGGAEL
1ydeM           AVFLAS-EANFCTGIELLVTGGAEL
1ydeI           AVFLAS-EANFCTGIELLVTGGAEL
1ydeH           AVFLAS-EANFCTGIELLVTGGAEL
1ydeG           AVFLAS-EANFCTGIELLVTGGAEL
1ydeF           AVFLAS-EANFCTGIELLVTGGAEL
1ydeD           AVFLAS-EANFCTGIELLVTGGAEL
1ydeB           AVFLAS-EANFCTGIELLVTGGAEL
1ydeA           AVFLAS-EANFCTGIELLVTGGAEL
3grpD           TVYLASDEAAYLTGQTLHINGG---
1ja9A           VSALCQEESEWINGQVIKLTGGG--
2ztuA           AVFLASDAAAQITGTTVSVDGG---
1k2wA           AIFLATPEADYIVAQTYNVDGG---
2b4qB           AISLAGTAGAYMTGNVIPIDGG---
2ewmB           XXXXXXXXXXXITGQTLAVDGG---
1zjyA           CVYLASNESKFATGSEFVVDGG---
1nxqA           CVYLASNESKFATGSEFVVDGG---
2ewmA           XXXXXXXXXXXITGQTLAVDGG---
2bgkA           VAYLAGDESKYVSGLNLVIDGG---
2ew8A           XXXXXXXXXXXITGQTLAVDGG---
2ew8B           XXXXXXXXXXXITGQTLAVDGG---
1e6wA           VQMVIEN--PFLNGEVIRLDG----
3iccA           AAFLASPDSRWVTGQLIDVSGGSCL
3i4fC           ISFLCEDDSDMITGTIIEVTG----
3i4fD           ISFLCEDDSDMITGTIIEVTG----
3i4fA           ISFLCEDDSDMITGTIIEVTG----
1e3wA           VQMVIEN--PFLNGEVIRLDG----
1w73A           AAFLCSDYASWINGAVIKFDGG---
1nffA           VVYLASDESSYSTGAEFVVDGG---
3gvcD           VVFLLSDDASMITGTTQIADGG---
2et6A           VLYLSSAE-NELTGQFFEVAAG---
1e6wD           VQMVIEN--PFLNGEVIRLDG----
3gvcC           VVFLLSDDASMITGTTQIADGG---
3gvcB           VVFLLSDDASMITGTTQIADGG---
1w73C           AAFLCSDYASWINGAVIKFDGG---
3gvcA           VVFLLSDDASMITGTTQIADGG---
1w73D           AAFLCSDYASWINGAVIKFDGG---
1p33C           VIFLCSPKAKYITGTCIKVDGGYSL
1p33B           VIFLCSPKAKYITGTCIKVDGGYSL
1p33A           VIFLCSPKAKYITGTCIKVDGGYSL
3gedB           VLFLCQQD--FITGETIIVDGGMS-
3gedA           VLFLCQQD--FITGETIIVDGGMS-
1p33D           VIFLCSPKAKYITGTCIKVDGGYSL
1e6wC           VQMVIEN--PFLNGEVIRLDG----
2a4kB           ALFLLSEESAYITGQALYVDGGRSI
1xq1A           VAFLCMPAASYITGQTICVDGG---
1w73B           AAFLCSDYASWINGAVIKFDGG---
1uluB           GLFLLSPLASGITGEVVYVDAG---
1e6wB           VQMVIEN--PFLNGEVIRLDG----
1rwbA           XXXXXXXXXXYVTGITLFADGGMTL
2qioA           AVFLFSDLARGVTGENIHVDSG---
3gegA           VLFLCQQD--FITGETIIVDGGMS-
2dknA           IAFLLGPQASFIHGSVLFVDGG---
1g6kA           XXXXXXXXXXYVTGITLFADGG---
1nfrA           VVYLASDESSYSTGAEFVVDGG---
1u7tA           VQAIIEN--PFLNGEVIRLDG----
3diiA           VLFLCQQD--FITGETIIVDGGMS-
1pwxA           VAFLASGSCDYLTGQVFWLAGG---
1mxfA           XXFLVSKDAGYITGTTLKVDGG---
1geeA           XXXXXXXXXXYVTGITLFADGGMTL
1e3sA           VQMVIEN--PFLNGEVIRLDG----
3ctmA           YLYLASNASTFTTGSDVVIDGG---
1uayB           VLHILEN--PMLNGEVVRLDG----
1gcoA           XXXXXXXXXXYVTGITLFADGG---
1uayA           VLHILEN--PMLNGEVVRLDG----
2qhxC           VIFLCSSKAKYITGTCVKVDGGYSL
3dijA           VLFLCQQD--FITGETIIVDGGMS-
1uluA           GLFLLSPLASGITGEVVYVDAG---
1zmoA           ITFLASRRAAPIVGQFFAFTGG---
2jjyC           VAFLCSDMATGITGEVVHVDAG---
2jjyB           VAFLCSDMATGITGEVVHVDAG---
3ctmF           YLYLASNASTFTTGSDVVIDGG---
2jjyA           VAFLCSDMATGITGEVVHVDAG---
2bf7C           VIFLCSSKAKYITGTCVKVDGGYSL
2o23B           VQAIIEN--PFLNGEVIRLDG----
2o23A           VQAIIEN--PFLNGEVIRLDG----
1mxhA           XXFLVSKDAGYITGTTLKVDGG---
1e7wB           VIFLCSSKAKYITGTCVKVDGGYSL
2b37B           VCALLSDWLPATTGDIIYADGG---
3ek2C           GAFLLSDLASGVTAEVMHVDSG---
3ctmH           YLYLASNASTFTTGSDVVIDGG---
3ctmD           YLYLASNASTFTTGSDVVIDGG---
3ctmB           YLYLASNASTFTTGSDVVIDGG---
1zbqA           VLWL---------------------
1uluD           GLFLLSPLASGITGEVVYVDAG---
2p8kH           VIFLCSSKAKYITGTCVKVDGGYSL
2jjyD           VAFLCSDMATGITGEVVHVDAG---
2fwmX           ILFLASDLASHITLQDIVVDGGSTL
3ek2A           GAFLLSDLASGVTAEVMHVDSG---
2yw9H           GLFLLSPLASGITGEVVYVDAG---
2p8kC           VIFLCSSKAKYITGTCVKVDGGYSL
2bfmC           VIFLCSSKAKYITGTCVKVDGGYSL
2bf7B           VIFLCSSKAKYITGTCVKVDGGYSL
1uluC           GLFLLSPLASGITGEVVYVDAG---
3ctmE           YLYLASNASTFTTGSDVVIDGG---
1w0cG           VIFLCSSKAKYITGTCVKVDGGYSL
2qhxA           VIFLCSSKAKYITGTCVKVDGGYSL
3ek2D           GAFLLSDLASGVTAEVMHVDSG---
3ctmC           YLYLASNASTFTTGSDVVIDGG---
2bfoC           VIFLCSSKAKYITGTCVKVDGGYSL
2bf7D           VIFLCSSKAKYITGTCVKVDGGYSL
2qhxD           VIFLCSSKAKYITGTCVKVDGGYSL
1e7wA           VIFLCSSKAKYITGTCVKVDGGYSL
2bfaC           VIFLCSSKAKYITGTCVKVDGGYSL
2p8kG           VIFLCSSKAKYITGTCVKVDGGYSL
2p8kD           VIFLCSSKAKYITGTCVKVDGGYSL
3ek2B           GAFLLSDLASGVTAEVMHVDSG---
1e92B           VIFLCSSKAKYITGTCVKVDGGYSL
2bfaD           VIFLCSSKAKYITGTCVKVDGGYSL
2yw9B           GLFLLSPLASGITGEVVYVDAG---
1lxcA           AAFLCSDLSAGISGEVVHVDGGFSI
1e92D           VIFLCSSKAKYITGTCVKVDGGYSL
1e92C           VIFLCSSKAKYITGTCVKVDGGYSL
3ctmG           YLYLASNASTFTTGSDVVIDGG---
2bfpD           VIFLCSSKAKYITGTCVKVDGGYSL
2b35B           VCALLSDWLPATTGDIIYADGG---
1w0cH           VIFLCSSKAKYITGTCVKVDGGYSL
1w0cC           VIFLCSSKAKYITGTCVKVDGGYSL
2bfpB           VIFLCSSKAKYITGTCVKVDGGYSL
2bfaB           VIFLCSSKAKYITGTCVKVDGGYSL
2bfaA           VIFLCSSKAKYITGTCVKVDGGYSL
2bf7A           VIFLCSSKAKYITGTCVKVDGGYSL
1w0cF           VIFLCSSKAKYITGTCVKVDGGYSL
1w0cE           VIFLCSSKAKYITGTCVKVDGGYSL
1w0cB           VIFLCSSKAKYITGTCVKVDGGYSL
1w0cA           VIFLCSSKAKYITGTCVKVDGGYSL
2p8kB           VIFLCSSKAKYITGTCVKVDGGYSL
2p8kA           VIFLCSSKAKYITGTCVKVDGGYSL
2gdzA           LITLIEDDA----------------
1e92A           VIFLCSSKAKYITGTCVKVDGGYSL
2bfoA           VIFLCSSKAKYITGTCVKVDGGYSL
2bfmB           VIFLCSSKAKYITGTCVKVDGGYSL
2o2sA           ALFLLSPLARAVSGVTLYVDNG---
1fk8A           IAFLMSPAASYVHGAQIVIDGG---
1dfiA           AAFLCSDLSAGISGEVVHVDGGFSI
1bdbA           VFFATRGDAAPATGALLNYDGG---
2b35F           VCALLSDWLPATTGDIIYADGG---
2b35D           VCALLSDWLPATTGDIIYADGG---
2b35C           VCALLSDWLPATTGDIIYADGG---
2yw9D           GLFLLSPLASGITGEVVYVDAG---
1i30A           AAFLCSDLSAGISGEVVHVDGGFSI
3fnfB           VCALLSDWLPATTGDIIYADGG---
2yw9F           GLFLLSPLASGITGEVVYVDAG---
1qsgG           AAFLCSDLSAGISGEVVHVDGGFSI
1qsgA           AAFLCSDLSAGISGEVVHVDGGFSI
1qg6A           AAFLCSDLSAGISGEVVHVDGGFSI
1hxhA           VLFLASDESSVMSGSELHAD-----
2fhsB           AAFLCSDLSAGISGEVVHVDGGFSI
2ehdB           -------------------------
1c14A           AAFLCSDLSAGISGEVVHVDGGFSI
2yw9E           GLFLLSPLASGITGEVVYVDAG---
2yw9A           GLFLLSPLASGITGEVVYVDAG---
1yb1A           IAFLTTLE-----------------
1gz6A           VLWL---------------------
2aqiA           VCALLSDWLPATTGDIIYADGG---
2h7iA           VCALLSDWLPATTGDIIYADGG---
1gz6C           -------------------------
1gz6B           -------------------------
1fduC           -------------------------
1enyA           VCALLSDWLPATTGDIIYADGG---
1bhsA           -------------------------
2b36B           VCALLSDWLPATTGDIIYADGG---
2b35A           VCALLSDWLPATTGDIIYADGG---
2aqhA           VCALLSDWLPATTGDIIYADGG---
2aq8A           VCALLSDWLPATTGDIIYADGG---
1a27A           -------------------------
2yw9C           GLFLLSPLASGITGEVVYVDAG---
2p91A           AVFLCSDWARAITGEVVHVDNG---
1iolA           -------------------------
3fneB           VCALLSDWLPATTGDIIYADGG---
2ehdA           -------------------------
2b35E           VCALLSDWLPATTGDIIYADGG---
2p91B           AVFLCSDWARAITGEVVHVDNG---
1fdvB           -------------------------
2dknB           IAFLLGPQASFIHGSVLFVDGG---
2nv6A           VCALLSDWLPATTGDIIYADGG---
2aqkA           VCALLSDWLPATTGDIIYADGG---
3fnfD           VCALLSDWLPATTGDIIYADGG---
2b37C           VCALLSDWLPATTGDIIYADGG---
2p91D           AVFLCSDWARAITGEVVHVDNG---
1lx6A           AAFLCSDLSAGISGEVVHVDGGFSI
3fneD           VCALLSDWLPATTGDIIYADGG---
1fjhA           IAFLMSPAASYVHGAQIVIDGG---
3fnfC           VCALLSDWLPATTGDIIYADGG---
3fneC           VCALLSDWLPATTGDIIYADGG---
2o2sB           ALFLLSPLARAVSGVTLYVDNG---
1fduD           -------------------------
1fduB           -------------------------
1fduA           -------------------------
1fdsA           -------------------------
1yb1B           IAFLTTLE-----------------
1qyxA           -------------------------
1qyvA           -------------------------
1jtvA           -------------------------
1fdwA           -------------------------
3deyX           -------------------------
2p91C           AVFLCSDWARAITGEVVHVDNG---
2ntvA           VCALLSEWLPATTGSIIYADGGAS-
2japC           VRYAVT-------------------
2japA           VRYAVT-------------------
3edmB           VAFLASDDAAYVTGACYDINGG---
3edmA           VAFLASDDAAYVTGACYDINGG---
1uh5A           ASFLLSRESRAITGQTIYVDNG---
2op0B           ASFLLSRESRAITGQTIYVDNG---
2oosB           ASFLLSRESRAITGQTIYVDNG---
2oosA           ASFLLSRESRAITGQTIYVDNG---
2ol4B           ASFLLSRESRAITGQTIYVDNG---
2ol4A           ASFLLSRESRAITGQTIYVDNG---
1enoA           AAFLVSPLASAITGATIYVDNG---
1d7oA           AAFLVSPLASAITGATIYVDNG---
1cwuA           AAFLVSPLASAITGATIYVDNG---
1vrwA           ASFLLSRESRAITGQTIYVDNG---
2pd3A           GMYXXXXXXXGVSGEVHFVDAG---
2o2yD           ASFLLSRESRAITGQTIYVDNG---
1zxlA           ASFLLSRESRAITGQTIYVDNG---
1zsnA           ASFLLSRESRAITGQTIYVDNG---
2o2yC           ASFLLSRESRAITGQTIYVDNG---
2o2yA           ASFLLSRESRAITGQTIYVDNG---
1so8A           -------------------------
3gy0A           -------------------------
3f5sB           -------------------------
3f5sA           -------------------------
2o50A           ALFLLSPLARAVSGVTLYVDNG---
2jahC           VRYAVT-------------------
2jahA           VRYAVT-------------------
2qq5A           -------------------------
3g1tA           -------------------------
3f1lB           -------------------------
3f1lA           -------------------------
2o50B           ALFLLSPLARAVSGVTLYVDNG---
3k2eA           ALYLLSDLGRGTTGETVHVDCG---
3grkD           GLYFLSDLSRSVTGEVHHADSG---
3grkA           GLYFLSDLSRSVTGEVHHADSG---
3gz4B           -------------------------
3gz4A           -------------------------
3e9nA           -------------------------
2bd0A           VVQAYLQPSRTVVEEIILRPTSGDI
3guyH           -------------------------
3guyG           -------------------------
3guyD           -------------------------
3guyC           -------------------------
3grkB           GLYFLSDLSRSVTGEVHHADSG---
3f5qB           -------------------------
3f5qA           -------------------------
3grkG           GLYFLSDLSRSVTGEVHHADSG---
3e9nC           -------------------------
3k2eB           ALYLLSDLGRGTTGETVHVDCG---
3guyA           -------------------------