[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:ACD30916.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1y2iA.bssp"
#ERROR : Can't open dsspfile "1vr4A.bssp"
#ERROR : Can't open dsspfile "1vr4C.bssp"
#ERROR : Can't open dsspfile "1ybbE.bssp"
#ERROR : Can't open dsspfile "1vr4E.bssp"
#ERROR : Can't open dsspfile "2gtcA.bssp"

## Summary of PDB Search
:106
    4e-08  34%  1y2iA  [d.230.5] HYPOTHETICAL PROTEIN S0862
    1e-07  36%  1vr4A  [x.x.x] HYPOTHETICAL PROTEIN APC22750
    1e-06  38%  1vr4C  [x.x.x] HYPOTHETICAL PROTEIN APC22750
    7e-06  40%  1ybbE  [x.x.x] HYPOTHETICAL PROTEIN APC22750
    2e-05  40%  1vr4E  [x.x.x] HYPOTHETICAL PROTEIN APC22750
    1e-04  34%  2gtcA  [x.x.x] UPF0145 PROTEIN BC_1816
:106

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MILTTADTLGKREIIEYKGLVTGIIVRTPTITQXXXXXXXXXXXXXXTSYTNVCKEARLHAEQEMINQAK
1y2iA           ---STTPTLEGLTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGGRSGAYEKELRKAREIAFEELGSQAR
1vr4A           MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVRDVVGGRAGSYESKLKEARDIAMDEMKELAK
1vr4C           MIVTTTSGIQGKEIIEYIDIVNGEAIMGANIVRDLFASVGGRAG----SYESKLKEARDIAMDEMKELAK
1ybbE           MIVTTTSGIQGKEIIEYIDIVNGEAIMGRDVVGGRAG-----------SYESKLKEARDIAMDEMKELAK
1vr4E           MIVTTTSGIQGKEIIEYIDIVNGEAIM----------GARDVVGGRAGSYESKLKEARDIAMDEMKELAK
2gtcA           -IVTTTSGIQGKEIIEYIDIVNGEAIGA-NIVRDLFASVRDVVGGRAGSYESKLKEARDIADEKEL--AK


                         .         .         *         .         .         .         .:140
query           ELGANAIVAIRYDSSSLGGNTSGTEVFCYGTAVVVR
1y2iA           ALGADAVVGIDIDYETVGQN--GSLVSVSGTAVKTR
1vr4A           QKGANAIVGVDVD-----------------------
1vr4C           QKGANAIVGVDVD-----------------------
1ybbE           QKGANAIVGVDVD-----------------------
1vr4E           QKGANAIVGVDVD-----------------------
2gtcA           QKGANAIVGVDVD-----------------------