[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for ftul2:capB

[Show Plain Result]

#ERROR : Can't open dsspfile "1w7kA.bssp"
#ERROR : Can't open dsspfile "1w78A.bssp"

## Summary of PDB Search
:405
    5e-05  27%  1w7kA  [x.x.x] FOLC BIFUNCTIONAL PROTEIN
    5e-05  27%  1w78A  [x.x.x] FOLC BIFUNCTIONAL PROTEIN
:405

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIKSIPIRIHVNGTRGKSSVARLIAAGVRAGGYRTVAKTTG
1w7kA           ------------------------------LKPAPFVFTVAGTNGKGTTCRTLESILMAAGYKVGVYSSP
1w78A           ------------------------------LKPAPFVFTVAGTNGKGTTCRTLESILMAAGYKVGVYSSP


                         .         .         *         .         .         .         .:140
query           TLARYIDVDGSETPVFRIGFSNIAEQVKIMFKARRAKADAIVIECMALQPLLQSLCELKLIKATHGVLTN
1w7kA           HLVRYVRVQGQELPAHTASFAEIESTLSALWLFKQAQLDVVILEV----GLGGRLDATNIVDADVAVVTS
1w78A           HLVRYVRVQGQELPAHTASFAEIESTLSALWLFKQAQLDVVILEV----GLGGRLDATNIVDADVAVVTS


                         +         .         .         .         .         *         .:210
query           ARPDHLDVMGPTERDVAKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1w7kA           IALDHTDWLGPDRESIGR----------------------------------------------------
1w78A           IALDHTDWLGPDRESIGR----------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1w7kA           ----------------------------------------------------------------------
1w78A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1w7kA           ----------------------------------------------------------------------
1w78A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1w7kA           -------------------------------------------------------
1w78A           -------------------------------------------------------